DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG33233

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster

Alignment Length:431 Identity:89/432 (21%)
Similarity:154/432 (36%) Gaps:129/432 (30%)


Human   164 GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARF----FLAMVASGYLV 224
            |::...:..|:.:||.||:.|:.........|.:.:|...|.|:....|.    ||:.|||  |.
  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVAS--LQ 130

Human   225 VGFVYVMEFIGMKSRTWASVHL------HSFFAVGTLLVAL------------TGYLVRTWWLYQ 271
            |||  :.||..:|   |..:.:      .....:...|||:            :.|.:|.|....
  Fly   131 VGF--LGEFHAIK---WRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLM 190

Human   272 MILSTVTVPFILCCW-------VLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLD 329
            |.       |::..|       ::||||.:|:|..|.::|...:..:.:.||      .:...:|
  Fly   191 MF-------FMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNR------KKWEDVD 242

Human   330 LQGPVSNSPTEVQK-------HNLSYLFYNWSITKRTLTVWLIW--FTGSLG---FYSFSLNSVN 382
            :......|.|..|:       :....||....:.|..:.::||:  |..|:|   ::....|..|
  Fly   243 ITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFLIFGIFFTSIGLGIWFPVIRNMDN 307

Human   383 LGGNEYLNLF---------------------------LLGVVEIPAYTFVCIAMDKVGRRTVLAY 420
            .|.|...:|.                           :..:::...|.|..|.            
  Fly   308 SGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIG------------ 360

Human   421 SLFCSALACGVVMVIPQKHYI-LGVVTAMVGKFAIGAAFG--------LIYLYTAELYPTIVRSL 476
               |..||..:|..:.:|:.| |.::.:|:    :|.:..        ||:.....:.|.::..|
  Fly   361 ---CFILASVLVHWMTRKYVIALHILISMI----LGISLNIMKQPTVVLIFFVLMMVLPGVLIPL 418

Human   477 AVG----------SGSMVCRLASILAPFSVDLSS--IWIFI 505
            |..          .|..:|.:.| ||.|...|.|  |.:||
  Fly   419 ATSVLVDCLPVNLRGKALCMVRS-LARFGGVLGSTMIGLFI 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 89/432 (21%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 85/423 (20%)
MFS 23..>208 CDD:119392 34/154 (22%)
MFS 354..>482 CDD:304372 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62666221
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.