DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AZR1 and CG33282

Sequence 1:NP_011740.3 Gene:AZR1 SGDID:S000003456 Length:613 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:445 Identity:88/446 (20%)
Similarity:157/446 (35%) Gaps:149/446 (33%)


Yeast    85 MIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLIS 149
            :.::.:||...::|..|...|        |   .|.||                |:|:       
  Fly    77 LTIAMLIERAGRKFCLYLMAG--------P---YACIW----------------ILIY------- 107

Yeast   150 ALANSMSMLIGGRVIAG-VGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVVG------ 207
             .|:::..|...|.:.| .||.|...:...| |.:.:.:.||.|.:::..|..:..:.|      
  Fly   108 -CASNVYYLYAARFLCGFTGGAGYLVVPIFI-SEVADSNIRGALTSMVMLSVDLGILAGYILSTY 170

Yeast   208 ------PFLGGVFTSSVTWRWCFYVNLPIGGLAFFL------------FLFFYNPGLSTFQETMD 254
                  |||..:...:.     |..|:.:...|.:|            |.::.|...:..::|..
  Fly   171 LAYHVVPFLAIILPVAY-----FIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSK 230

Yeast   255 -NIRKFPSQFI-EIVRN---VAYHLL----KIKGFS---------KLNGWRKPFMELIFMYDIIE 301
             |..:..:..: :..||   ::|..|    .:|||:         :.:|   .|..:.:|.||  
  Fly   231 VNFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSG---VFSFINYMSDI-- 290

Yeast   302 FVFCSAGFTCILLAFTFGGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFNIVKATPHYQP 366
                          |...|:....|:|:|    |||:|.:|  |:|...:.  .:||..    :.
  Fly   291 --------------FKASGSVVDVNTATI----IIGLVQIV--GVYTSTIL--VDIVGR----RV 329

Yeast   367 LMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAVHLVACIISTVVTAIL 431
            ||.        |.|:.:.:.....|.   |||:.:.:.|  :|..|...|.::  ||..|....|
  Fly   330 LML--------ISTMGVGIGCIAFGC---FTYLAKIYDL--SDFNWLPLVLMI--IICYVANIGL 379

Yeast   432 CGAITDKTRQIKPIIVISSIFGVVGAGILTLLNNNANNSAHIGLLILPGVAFGGL 486
            .|..         .:|:..:|.|....:.|.|:          ::.|..:.||.|
  Fly   380 IGIF---------FLVLVELFPVKIRSLATSLS----------VIFLSLLVFGTL 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AZR1NP_011740.3 MFS 83..>234 CDD:119392 30/162 (19%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 88/446 (20%)
MFS_1 53..409 CDD:284993 85/438 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.