DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TPO2 and CG33282

Sequence 1:NP_011654.1 Gene:TPO2 SGDID:S000003370 Length:614 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:473 Identity:101/474 (21%)
Similarity:181/474 (38%) Gaps:92/474 (19%)


Yeast   172 YTVLLSILVICVAYGSACISGGLGTVEKK---------YHVGMEAAILSCSLMVIGFSLGPLIWS 227
            |.:|.:::|..:.:|.....|.|.....|         :.|.:.......|::.:....|.|..:
  Fly    16 YQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIA 80

Yeast   228 PVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSET 292
            .:.:..||:...::..|.|....|....|.|:..|.|.|||||....:|..:|...|:::..|..
  Fly    81 MLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNI 145

Yeast   293 RGKAIAFFAFAPYVGPVVGPLVNGFISVS-TGRMDLIFWVNMAFAGVMWIISSAIPETYAPVILK 356
            ||...:....:..:|.:.|.:::.:::.. ...:.:|..|....|.:|      :||| ||.:||
  Fly   146 RGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIM------LPET-APYLLK 203

Yeast   357 RKAARLRKET----GNPKIMTEQEAQGVSMSEMMRACLLR------PLYF--AVTEPVLVATCFY 409
            :......:.:    .|.:....::...|:..|:..|.|.:      ||.:  ..|:|.|..  |.
  Fly   204 KSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALKG--FA 266

Yeast   410 VCLIYSLLYAF--FFAFPVIFGELYGYKDNLVGLMFIPIVIGALWALATTFYCENKYLQIVKQRK 472
            ..::.||.|.|  .|:|.....:::....::|.:....|:||              .:|||    
  Fly   267 ASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIG--------------LVQIV---- 313

Yeast   473 PTPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVGPASAGLAFG-FGMVLIYYSLNNY------ 530
                        |...:.|.:.|:|......|..:|.....:||| |..:...|.|:::      
  Fly   314 ------------GVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLV 366

Yeast   531 --IIDCYVQYASSALATKVFL----------RSAGGAAFPLF-------TIQMYHKLNLHWGSWL 576
              ||.|||  |:..|....||          ||...:...:|       |::::..:..:||...
  Fly   367 LMIIICYV--ANIGLIGIFFLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISF 429

Yeast   577 LAFISTAMIALPFAFSYW 594
            ..:.|.|...|.| |.:|
  Fly   430 TMWFSAASALLTF-FYFW 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TPO2NP_011654.1 MFS 173..587 CDD:119392 96/464 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 99/469 (21%)
MFS_1 53..409 CDD:284993 85/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.