DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP4F2 and Cyp6a8

Sequence 1:NP_001073.3 Gene:CYP4F2 HGNCID:2645 Length:520 Species:Homo sapiens
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:454 Identity:115/455 (25%)
Similarity:215/455 (47%) Gaps:47/455 (10%)


Human    87 GFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRML 151
            ||..:..|.:.::.|   ::.:.::....:.......||:..:..:...|....|.:|...|..|
  Fly    75 GFFFFQSPAAFVIDL---ELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWRLLRNKL 136

Human   152 TPAFHFNILK----PYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFD- 211
            :..|....:|    ..:.:.||.:.:||.|     ...::.|::.:.::..|:|.:..|.|... 
  Fly   137 SSTFTSGKMKLMYPTVVSVANEFMTVMHEK-----VPKNSVLEIRDLVARFTVDVIGTCAFGIQC 196

Human   212 SHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRR 276
            :..:::.:|::  .....:||.|||..:|......|      .:..|...:|.  |...|||...
  Fly   197 NSLRDEKAEFL--YFGKRSLVDKRHGTLLNGFMRSY------PKLARKLGMVR--TAPHIQEFYS 251

Human   277 TLPSQGVDDFLQAKAKSKTLDFIDVLLLSKD------EDG---KKLSDEDIRAEADTFMFEGHDT 332
            .:.::.|  .::.|...|..||:|:|:..|:      |:|   :.|:.|::.|:|..|...|.:|
  Fly   252 RIVTETV--AVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFET 314

Human   333 TASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPV 397
            ::|.:.:.||.|||:|:.|::.|.||:|:::..: :...::....|.:|...:.|:|||:..||.
  Fly   315 SSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHD-QNFTYECTKDLKYLNQVLDETLRLYTIVPN 378

Human   398 ISRHVTQDIVLP--DGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIP 460
            :.|...:..|:|  ...||..|...:|.....||:|:::|:|..:.|.||.||....|..:|::|
  Fly   379 LDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLP 443

Human   461 FSAGPRNCIGQTFAMAEMKVVLALTLLRFRVL-------PDHTEPRRKPELVLRAEGGLWLRVE 517
            |..|||||||..|...:.::.|||.:..|:..       |...:|:   ..||..:.|::|:||
  Fly   444 FGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPK---SFVLGVKDGIYLKVE 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP4F2NP_001073.3 p450 52..515 CDD:278495 113/451 (25%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 113/452 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.