DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HXT7 and CG33282

Sequence 1:NP_010629.3 Gene:HXT7 SGDID:S000002750 Length:570 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:505 Identity:120/506 (24%)
Similarity:204/506 (40%) Gaps:107/506 (21%)


Yeast    61 AYVTVSIMCIMIAFG-GFVFGWDTGTISGFINQT-----DFIRRFGMKHKDGTNYLSKVRTGLIV 119
            |.|.|:|    |.|| |...||.:.|::..  ||     ||             .::..:...:.
  Fly    20 ATVIVNI----ITFGHGVGVGWLSPTLTKI--QTADSPLDF-------------EVNLAQISWLG 65

Yeast   120 SIFNIGCAIGGIILSKLGDMYGRKVGLIVVVVIY-IIGIIIQIASINKWYQYFIGRIISGLGVGG 183
            |:..:....|.:.::.|.:..|||..|.::...| .|.|:|..|| |.:|.| ..|.:.|...|.
  Fly    66 SMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCAS-NVYYLY-AARFLCGFTGGA 128

Yeast   184 IAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVP--LGLCFAWA 246
            ..::.|:.||||:..::||.|.|...|.:..||..||.       .|..:.:.|.  |.:....|
  Fly   129 GYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYI-------LSTYLAYHVVPFLAIILPVA 186

Yeast   247 LFMIGGMTFVPESPRYLAEVGKIEEAKRSIAV--SNKVAVDDPSVLAEVEAVLAGVEAEKL--AG 307
            .|:...|  :||:..||.:..::..|:.|...  :.:.|:.:.:.....|.:...|.:::.  |.
  Fly   187 YFIANIM--LPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNAT 249

Yeast   308 NASWGELFSSKTKVLQRLIMGAMIQSL-QQLTGDNYFFYYGTTIFKAVG-LSDSFETSIVLGIVN 370
            ..|:.:|   .||...:....:::.|| .|.:|...|..|.:.||||.| :.|....:|::|:|.
  Fly   250 PLSYKDL---TTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQ 311

Yeast   371 FASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACF 435
            ....:....:|:..|||..:|                            .|:.|.|...|.|.||
  Fly   312 IVGVYTSTILVDIVGRRVLML----------------------------ISTMGVGIGCIAFGCF 348

Yeast   436 --------------------YIFCFATTWAPIP--YVVVSETFPLRVKSKAMSIATAANWLWGFL 478
                                .|.|:......|.  ::|:.|.||::::    |:||:.:.::..|
  Fly   349 TYLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIR----SLATSLSVIFLSL 409

Yeast   479 IGFFTPFITGAINFYYGYVF-----MGCLVFMFFYVLLVVPETKGLTLEE 523
            :.|.|..:...:..|:|..|     ....:..|||..|.:.||||.::.|
  Fly   410 LVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HXT7NP_010629.3 Sugar_tr 68..528 CDD:278511 116/499 (23%)
MFS 69..514 CDD:119392 111/487 (23%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 114/492 (23%)
MFS_1 53..409 CDD:284993 92/415 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97245982
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.