DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNF2 and CG33298

Sequence 1:NP_010378.1 Gene:DNF2 SGDID:S000002500 Length:1612 Species:Saccharomyces cerevisiae
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1639 Identity:443/1640 (27%)
Similarity:680/1640 (41%) Gaps:456/1640 (28%)


Yeast    20 GSASNGLSSMSPFDDSFQFEKPSSAHGNIEVAKTGGSVLKRQSKPMKDISTPDLSKVTFDGIDDY 84
            |||..|.....|   ......||..|.. .::..||:::....:|:|.         ...|....
  Fly    79 GSAPGGGGQGIP---GVAMAAPSRGHAR-SISHGGGAIVGANGRPIKS---------AMKGHQRA 130

Yeast    85 SNDNDINDDDELN-----------GKKTEI-----HEHENEVDDDLHSFQATPMPNTGGFEDVEL 133
            .:...|.|....:           |.||:.     |:.|...:      .:.|...|||      
  Fly   131 FSQGQITDSPPGSAAPAGRGHSRVGSKTDFILPPGHKEEPARE------PSAPTSATGG------ 183

Yeast   134 DNNEGSNNDSQADHKLKRVRFGTRRNKSGRIDINRSKTLKWAKK----NFHNAIDEFSTKEDSLE 194
               .|.:..:.....:..:|              |::...|.|:    |: |..|:|        
  Fly   184 ---RGHSRQASRSESIYTLR--------------RTEAPPWWKRLTLCNY-NTGDKF-------- 222

Yeast   195 NSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANI 259
                :.||  .|||..|..:|......|. |...:..|||||||||.|:|.|||:|.|||..||:
  Fly   223 ----EERS--YRTVVPNHTVPPKTPKRDH-PNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANL 280

Yeast   260 YFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNE 324
            ||:.:::|.............|.:|::.::.:||:||..||.||...|..:|||..         
  Fly   281 YFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTC--------- 336

Yeast   325 NVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGREKKLQKKREELRRKRNSRSFGPRGSLDS 389
                                                                             
  Fly   337 ----------------------------------------------------------------- 336

Yeast   390 IGSYRMSADFGRPSLDYENLNQTMSQANRYNDGENLVDRTLQPNPECRFAKDYWKNVKVGDIVRV 454
                                        |..|||..           |:.|..|:.::|||||.:
  Fly   337 ----------------------------RVYDGETE-----------RYKKVKWQELRVGDIVHL 362

Yeast   455 HNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLK----CSKIIKSSRDITRTKFWVE 515
            .||:.:|||::||.|||..|.||::|.:||||||||.|:.::    ...|...|:.::|    ||
  Fly   363 SNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSR----VE 423

Yeast   516 SEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINA 580
            ::.|...||.:.|.......:     ..|::...||||...|:||.:..|:|::.|.:||.|:|.
  Fly   424 ADAPTTKLYRFHGALIHPTGE-----RVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNN 483

Yeast   581 GVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFV 645
            .....|:|::.:::|..||...::|.|||    :|..:..:....|..:|....:..:..|....
  Fly   484 SGPRYKRSQVEQQMNIDVIWCVIILLILC----VVGAIGCRMWLSSFTHFPVPYLPPNKLTANME 544

Yeast   646 S---FWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIE 707
            |   ||..:::.|.::|:|||:::|:.|..|...|:.:|.|::|:.:.....::.||:::||||:
  Fly   545 SMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQ 609

Yeast   708 YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMI 772
            :||:|||||||:|.|.|::|.:||..|....:| |..:..:.|.....         ....:.:.
  Fly   610 HIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSE-LEKIYSKPGAPAPP---------LIPNDNLN 664

Yeast   773 DELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLV--EPNKD--- 832
            .::..::..|...|                    |.|: .:.||:.||:|::|:|  .|::|   
  Fly   665 SDMAQLTQGTYLTP--------------------HAQR-IQEFLVVLAICNTVIVGAAPHRDMMN 708

Yeast   833 ---------------------------------------------DPKKLDI------------- 839
                                                         .|:.:.|             
  Fly   709 ASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRS 773

Yeast   840 ----------------------------------------------------------------- 839
                                                                             
  Fly   774 VTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINS 838

Yeast   840 --------------------------------------KAQSPDESALVSTARQLGYSFVGSSKS 866
                                                  :|:||||.|||:.|.......:..|.:
  Fly   839 KITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPN 903

Yeast   867 GLIVE--IQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRL--- 926
            .::|.  :.|..:|:::|.||.|:||||.||.:::..||     .:.:|..|||||.|...|   
  Fly   904 QILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGS-----QEIVLYTKGADSSIMPVLVPC 963

Yeast   927 DRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVT 991
            .....:..|.|:|...|:.||.||||.|.:|:|.|..::|..|...:.....|:.|||..|....
  Fly   964 SHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSF 1028

Yeast   992 DVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELL 1056
            ..:|..|.|||.|.||||||||||::||.|..|||.:|||||||.||||||.:|..:....|||:
  Fly  1029 AKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELI 1093

Yeast  1057 VVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMS-GSEEELKEAKREHGLPQGNFAVIIDGDAL 1120
            .:.|...|..|      ..:|..:|....:|...: |..:.|::.:|         |:::||..|
  Fly  1094 RLTARSRDAAE------TAINFYLTDMENDKTTSTLGYGQSLRKKQR---------ALVVDGKTL 1143

Yeast  1121 KVALNGE-EMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSA 1184
            ...|:.: ::...||.|.|.|.:|||||.:|.|||.:||:||:.|::.|||||||:|||:|||.|
  Fly  1144 TFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMA 1208

Yeast  1185 DVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYG 1249
            ||||||:|:||.||||.:|:.:.:|||:.||:|.||.|||.||:.||..|||||..|...:|||.
  Fly  1209 DVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQ 1273

Yeast  1250 IYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFL 1314
            :|..|.|..:.:..||..|||.|||:|.:.:.|.|:.|::.:.:..|.||:.|.|...:....|.
  Fly  1274 LYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFW 1338

Yeast  1315 WYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNF----YVFMEQY 1375
            ..:||.:|||::.||....||      .|:.:|:   :..|..:||    ||.|    :..:|..
  Fly  1339 LILLDALYQSLVIFFVALCAY------AESDVGI---WEFGTTITA----SCLFANLVHCAIEIR 1390

Yeast  1376 RWDWFCGLFICLSLAVFYGWTGIWTSSSSS----NEFYKGAARVFAQPAYWAVLFVGVLFCLLPR 1436
            .|.....|.|.|||..||.:..::.|...:    ...|......||...:|.|:.:..:..:|||
  Fly  1391 SWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPR 1455

Yeast  1437 FTIDCIRKIFYPKD 1450
            ..:..:|....|.|
  Fly  1456 LLLTTVRISLCPDD 1469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNF2NP_010378.1 ATPase-Plipid 229..1456 CDD:273734 401/1411 (28%)
PhoLip_ATPase_N <229..278 CDD:292826 23/49 (47%)
E1-E2_ATPase <444..>486 CDD:278548 22/42 (52%)
Cation_ATPase 821..928 CDD:289987 40/278 (14%)
PhoLip_ATPase_C 1199..1448 CDD:292829 84/257 (33%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 401/1411 (28%)
E1-E2_ATPase 302..>394 CDD:278548 43/205 (21%)
Cation_ATPase <880..965 CDD:289987 32/90 (36%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139720119
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 653 1.000 Inparanoid score I104
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.760

Return to query results.
Submit another query.