DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DRS2 and CG33298

Sequence 1:NP_009376.2 Gene:DRS2 SGDID:S000000024 Length:1355 Species:Saccharomyces cerevisiae
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1412 Identity:417/1413 (30%)
Similarity:648/1413 (46%) Gaps:316/1413 (22%)


Yeast    28 TTSHSGSRSKVTNSHANAN-----YIPPSHVLPEETIDLDADDDNIENDVHENLFMSNNHDDQTS 87
            |.|..||.:.....|:...     .:||.|          .::...|.....:......|..|.|
  Fly   137 TDSPPGSAAPAGRGHSRVGSKTDFILPPGH----------KEEPAREPSAPTSATGGRGHSRQAS 191

Yeast    88 WNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYL 152
            .:.:.:        :||..:.|..:.|        .|.......:.||...|..|..|.......
  Fly   192 RSESIY--------TLRRTEAPPWWKR--------LTLCNYNTGDKFEERSYRTVVPNHTVPPKT 240

Yeast   153 DSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKF 217
            ..|:                    ..||:                :..|.|.||||...:|:||.
  Fly   241 PKRD--------------------HPNGQ----------------FVGNKIRTTKYTLLSFIPKN 269

Yeast   218 LFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNS 282
            |.::|.:.|||:|:....:..||.:|...:...:..:|.||.|:|:|:..||.:|..|||.:||:
  Fly   270 LLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNT 334

Yeast   283 TAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKI 347
            |..::....:.:.:.:|.::|||||:.:.:.|.:|||.::|.:|:|:|:|||:|.:||||||||.
  Fly   335 TCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKR 399

Yeast   348 K---------QSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMT-LNDRQIPLSPDQMIL 402
            :         ||....:||:         .:|.::.|.:.||.:.|.:. ....::|:|.:.::|
  Fly   400 REVVRGFEEMQSIFVPSKFV---------SRVEADAPTTKLYRFHGALIHPTGERVPISTECLLL 455

Yeast   403 RGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIALFTVLIVLILISSIGNV 467
            |.:.|:||.:|.|:|::.|||||.:.|.:....||:.||:.:|..:|....:|::|.::.:|| .
  Fly   456 RESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIG-C 519

Yeast   468 IMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFMIGSDL 529
            .|..:...|....||. .||.....:....||   ::...::|:||:||:||.|..|.|.|.:::
  Fly   520 RMWLSSFTHFPVPYLP-PNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNV 583

Yeast   530 DLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY------IDK--- 585
            ||:..:|:..|..|..::.||||||::||:|||||||.|.|.|:.|.:.|..|      ::|   
  Fly   584 DLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYS 648

Yeast   586 ---------IPEDK----TATVEDG----------------------IEVGYRKFDDL------- 608
                     ||.|.    .|.:..|                      :.||.....|:       
  Fly   649 KPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGII 713

Yeast   609 -----------------KKKL--------------NDP--------------------------- 615
                             ::||              |.|                           
  Fly   714 EVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSP 778

Yeast   616 -----------------------------SDEDSP---------------------IINDFLTLL 630
                                         |:.:||                     :||..:|.:
  Fly   779 PPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSI 843

Yeast   631 ATC--------HTVIPEFQ-------SDGSIKYQAASPDEGALVQGGADLGYKFIIRKPNSVTVL 680
            ||.        ...:|..:       :||...|:|.||||.|||..........:.|.||.:.|.
  Fly   844 ATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVS 908

Yeast   681 LEETGEEKEYQLLNICEFNSTRKRMSAIFR-FPDGSIKLFCKGADTVILERLDDEANQYVEATMR 744
            :...|..:||::|.:..|:|:||.||.:.| .....|.|:.||||:.|:..|...::...|..:|
  Fly   909 MPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILR 973

Yeast   745 H-----LEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILI 804
            .     |:.||.||||.|.:|.|.::..:|.:|.:.:.|...:|:||..:|.::...:|.||.|:
  Fly   974 EQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLL 1038

Yeast   805 GATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDT 869
            |||.|||:|||||||||.:|..|||.:||||||:.||||||..|.:|.::.|.|:.:...:||..
  Fly  1039 GATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAA 1103

Yeast   870 ERNLLEKINALN------EHQLSTHDMNTL-----------ALVIDGKSLGFALEPELEDYL--L 915
            |       .|:|      |:..:|   :||           |||:|||:|.|.|:|:.:..|  |
  Fly  1104 E-------TAINFYLTDMENDKTT---STLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFL 1158

Yeast   916 TVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 980
            .::|.|.:|:|||.:|||||.:||:||.:.:...||||||||||||||.|.|||||||.|||||.
  Fly  1159 RLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAV 1223

Yeast   981 RSADIAVGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWT 1045
            .:||..:.:|::|::|||.||.|.|.|:|..|||.||||.|.....|||.....||||.:|:...
  Fly  1224 MAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMY 1288

Yeast  1046 MSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFI 1110
            :..|||.||..||..|||:|:.|:..||.:.|.|||.|:.|..:..:.||..:::..:.|.::|.
  Fly  1289 LMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFF 1353

Yeast  1111 GTILIYRYGFALNMHGELADH----WSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLF 1171
            ..:..|            |:.    |.:|.|:..:.:...|...|:....||...:::|..||..
  Fly  1354 VALCAY------------AESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGS 1406

Yeast  1172 WLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALV 1218
            :.:|..:|.|:..:....|..|.|:...:.|.|.||.:::..:.|::
  Fly  1407 FYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVL 1453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DRS2NP_009376.2 PhoLip_ATPase_N 184..249 CDD:292826 18/65 (28%)
ATPase-Plipid 198..1240 CDD:273734 392/1238 (32%)
E1-E2_ATPase 254..>342 CDD:278548 36/88 (41%)
Cation_ATPase 633..732 CDD:289987 35/115 (30%)
HAD_like <812..997 CDD:304363 97/204 (48%)
PhoLip_ATPase_C 980..1232 CDD:292829 76/244 (31%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 18/66 (27%)
ATPase-Plipid 250..1473 CDD:273734 392/1238 (32%)
E1-E2_ATPase 302..>394 CDD:278548 36/92 (39%)
Cation_ATPase <880..965 CDD:289987 30/85 (35%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.