DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GAL2 and CG33282

Sequence 1:NP_013182.1 Gene:GAL2 SGDID:S000004071 Length:574 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:500 Identity:109/500 (22%)
Similarity:197/500 (39%) Gaps:115/500 (23%)


Yeast    78 VAFG-GFMFGWDTGTISGFVVQT-----DFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGG 136
            :.|| |...||.:.|::  .:||     ||             .::..:...:.::..:....|.
  Fly    27 ITFGHGVGVGWLSPTLT--KIQTADSPLDF-------------EVNLAQISWLGSMLGLDSLCGN 76

Yeast   137 IILSKGGDMYGRKKGLSIVVSVY-IVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISE 200
            :.::...:..|||..|.::...| .:.|:|..|| |.:|.| ..|.:.|...|...::.|:.|||
  Fly    77 LTIAMLIERAGRKFCLYLMAGPYACIWILIYCAS-NVYYLY-AARFLCGFTGGAGYLVVPIFISE 139

Yeast   201 IAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIGALTLVPES 265
            :|..::||.|.|...|.:..||..||.       .|..:.:.|...|.....:....|..::||:
  Fly   140 VADSNIRGALTSMVMLSVDLGILAGYI-------LSTYLAYHVVPFLAIILPVAYFIANIMLPET 197

Yeast   266 PRYLCEVNKVEDAKRSI-----------AKSNKVSPED--PAVQAELDLIMAGIEAEKLAGNASW 317
            ..||.:.:::..|:.|.           .:::||:.|:  .||.:         :..:.|...|:
  Fly   198 APYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLS---------QQTRNATPLSY 253

Yeast   318 GELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVG-LDDSFETSIVIGVVNFASTF 381
            .:|  |.....:.....:.:.:..|.:|...|..|.:.|||:.| :.|....:|:||:|.....:
  Fly   254 KDL--TTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVY 316

Yeast   382 FSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGAGNCMIVFTCF----- 441
            .|...|:.:|.|..:|:                            |:.|.|...|.|.||     
  Fly   317 TSTILVDIVGRRVLMLI----------------------------STMGVGIGCIAFGCFTYLAK 353

Yeast   442 ---------------YIFCYATTWAPVA--WVITAESFPLRVKSKCMALASASNWVWGFLIAFFT 489
                           .|.||......:.  :::..|.||::::|    ||::.:.::..|:.|.|
  Fly   354 IYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRS----LATSLSVIFLSLLVFGT 414

Yeast   490 PFITSAINFYYGYVF-----MGCLVAMFFYVFFFVPETKGLSLEE 529
            ..:...:..|:|..|     ....:..|||.:.|:.||||.|:.|
  Fly   415 LKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GAL2NP_013182.1 Sugar_tr 74..534 CDD:278511 109/500 (22%)
MFS 75..518 CDD:119392 102/488 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 102/488 (21%)
MFS_1 53..409 CDD:284993 85/421 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97245782
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.