DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT1G72700 and CG33298

Sequence 1:NP_001322799.1 Gene:AT1G72700 AraportID:AT1G72700 Length:1228 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1350 Identity:430/1350 (32%)
Similarity:662/1350 (49%) Gaps:289/1350 (21%)


plant     3 RGRIRSKLRLSLLYTFGCLRPATLEGQDSQPIQGPGFSRTVFCNQPHMHKKKPLRYRS------- 60
            ||..|...|...:||   ||      :...|   |.:.|...||.....|.:...||:       
  Fly   184 RGHSRQASRSESIYT---LR------RTEAP---PWWKRLTLCNYNTGDKFEERSYRTVVPNHTV 236

plant    61 ----------------NYVSTTRYNLITFFPKSLYEQFHRAANLYFLVAAILSVFP-LSPFNKWS 108
                            |.:.||:|.|::|.||:|.|||||.|||||:...:|:..| :|.|.|..
  Fly   237 PPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEV 301

plant   109 MIAPLVFVVGLSMLKEALEDWRRFMQDVKINARKTCVHKSDGV---FRQRKWKKVSVGDIVKVEK 170
            .:.|::||:|::.:|:..||.||...|.:|| ..|| ...||.   :::.||:::.|||||.:..
  Fly   302 AMIPVLFVLGVTAVKDLFEDRRRRASDKRIN-NTTC-RVYDGETERYKKVKWQELRVGDIVHLSN 364

plant   171 DEFFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRSLEVSLPLDDDESF---KNFMATIRCED 232
            :|..|||:|||.:|...|:||::|.:||||||||.:   ||....::.:|.   ..|::.:..:.
  Fly   365 NETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR---EVVRGFEEMQSIFVPSKFVSRVEADA 426

plant   233 PNPNLYTFVGNLEFER-QTFPLDPSQILLRDSKLRNTTYVYGVVVFTGFDTKVMQNSTKSPSKRS 296
            |...||.|.|.|.... :..|:....:|||:|:|:||.|:.|:||:.|.:||.|.|::....|||
  Fly   427 PTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRS 491

plant   297 RIERTMDY-IIYTLLVLLIL-----ISCISSSGFAWETEF-HMPKMWYLRPGEPIDFTNPINPIY 354
            ::|:.|:. :|:.:::||||     |.|     ..|.:.| |.| :.||.|          |.:.
  Fly   492 QVEQQMNIDVIWCVIILLILCVVGAIGC-----RMWLSSFTHFP-VPYLPP----------NKLT 540

plant   355 AGVVHL---ITALLLYGYLIPISLYVSIEVVKVWQASFINQDLHMYDDESGVPANARTSNLNEEL 416
            |.:..:   .|.:::...:||:||||:||:.|:.|...|:.::.::|.|:......|..|:.|||
  Fly   541 ANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEEL 605

plant   417 GQVHTILSDKTGTLTCNQMDFLKCSIAGTSYGVRSSEVEVAAAKQMA------------------ 463
            ||:..|.:|||||||.|:|.|.:|.:.|:.|....||:|...:|..|                  
  Fly   606 GQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQL 670

plant   464 ------------------------------------------VDLEE---------HGE------ 471
                                                      :::::         ||:      
  Fly   671 TQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLL 735

plant   472 ISSTPQSQTKVYGTWDSSRTQEIEVEGD------------------------------------- 499
            .|||..:.|.......:::.|.:.:..|                                     
  Fly   736 ASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISS 800

plant   500 -------NNYNTPRAPIKGFGFEDNRLMNGNWLRESQPNDILQFFRILAICHTAIPE----LNEE 553
                   :...:|..|:|               .:|..|.|....|..|:.::.|..    ||.:
  Fly   801 SAESSPNSESESPSPPMK---------------NKSLSNSISPTGRAKAVINSKITSIATFLNAK 850

plant   554 T--------------------GKYTYEAESPDEASFLAAAREFGFEFFKRTQSSVFIRERFSGSG 598
            |                    |:..||||||||.:.:.||..:......|:.:.:.:....:|: 
  Fly   851 TQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGA- 914

plant   599 QIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQ-ILLLCKGADSIIFERLA----KNGKTYLGPTT 658
               .|||::|.:|.|.|.||.|:::||....| |:|..|||||.|...|.    .:.:..|...|
  Fly   915 ---TREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQT 976

plant   659 RHLTE-YGEAGLRTLALAYRKLDEDEYAAWNSEFLKAKTSIGSDRDELLETGADMIEKELILIGA 722
            :.|.: |...|||.|.:|.|.|:..:|..|.:...:.:.|: .:|:..|......:|..|.|:||
  Fly   977 QQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSL-ENRERRLRDSFAKLESNLTLLGA 1040

plant   723 TAVEDKLQKGVPQCIDKLAQAGLKLWVLTGDKMETAINIGFACSLLRQGMRQICITSMNSEGGSQ 787
            |.:||:||.|||:.|..|..||:.:|||||||.||||||.::..|..|.|..|.:|:.:      
  Fly  1041 TGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARS------ 1099

plant   788 DSKRVVKENILNQLTKAVQMVKLEKDPHAAF------------ALIIDGKTLTYALEDDMK--YQ 838
               |...|..:|     ..:..:|.|...:.            ||::||||||:.|:...|  ..
  Fly  1100 ---RDAAETAIN-----FYLTDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILP 1156

plant   839 FLALAVDCASVICCRVSPKQKALVVRLVKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQ 903
            ||.|:..||||:|||.:|.|||.:|::|||.....|||||||||||.|||.||:||||||.||||
  Fly  1157 FLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQ 1221

plant   904 AVMASDFSIAQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTLFYFEAFTGFSGQSVYND 968
            ||||:||::.:||:|||||:.||:|||.|:::||.||||||.||...:|:::.:.|||||.:.:.
  Fly  1222 AVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQ 1286

plant   969 YYLLLFNVVLTSLPVIALGVFEQDVSSEICLQFPALYQQGTKNLFF---DWSRILGWMCNGVYAS 1030
            .||:|:|::.||||.:|:||:::.|:.::.|:.|.||:.|...:.:   |:..||   .:.:|.|
  Fly  1287 MYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLIL---LDALYQS 1348

plant  1031 LVIFFLNIGIIYSQAFRDNGQTADMDAVGTTMFTCIIWAANVQIALTMSHFTWIQHVL-IWGSIG 1094
            |||||:.: ..|:::  |.|    :...|||:....::|..|..|:.:..:| :.||| |..|:|
  Fly  1349 LVIFFVAL-CAYAES--DVG----IWEFGTTITASCLFANLVHCAIEIRSWT-VLHVLSIVLSLG 1405

plant  1095 MWYLFVAIYSMMPPSYSG--NIYRILDEILAPAPIYWMATLLVTVAAVLP 1142
            .:|||..:|..:..:..|  :.|.::....|.| ::|:..:|.||.||||
  Fly  1406 SFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASA-VHWLVIMLSTVVAVLP 1454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT1G72700NP_001322799.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 414/1272 (33%)
E1-E2_ATPase 302..>394 CDD:278548 38/94 (40%)
Cation_ATPase <880..965 CDD:289987 30/89 (34%)
HAD_like <1177..1240 CDD:304363 44/63 (70%)
PhoLip_ATPase_C 1223..1468 CDD:292829 93/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.