DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CASP10 and Strica

Sequence 1:NP_116759.2 Gene:CASP10 HGNCID:1500 Length:522 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster

Alignment Length:407 Identity:103/408 (25%)
Similarity:161/408 (39%) Gaps:86/408 (21%)


Human   138 LKDSLPKTEMTSLSFLA------FLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQI 196
            ||.|.||....|.:..|      ::....:.....:||.....||  ||...:...   ..|..|
  Fly   172 LKGSRPKATWASFASTANSSTSSYVSPYRQKPSMAITCTSPNIKT--PKTTSSTSS---SSASSI 231

Human   197 VTPPVDKEAES----------YQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSL 251
            .:||....:.|          .|.::.|.|....|.|:.           .||:|..........
  Fly   232 TSPPKPSSSVSSISSIFKSAPKQVDKPLSSTATPKPFIS-----------LGSSGGTKPKVTAVA 285

Human   252 VSRGMQGASANTLNSETST------KRAAVYRMNRNHRGLCVIVNNHSFTSLKD-RQGTHKDAEI 309
            .|:..||..:.:|....|:      |.|.||           |.|:..|.:..: |:|:.:|.::
  Fly   286 QSQDAQGTISTSLGISKSSLTKNKLKPARVY-----------IFNHERFDNKNEFRKGSAQDVKV 339

Human   310 LSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHG-RFGAV------YSS 367
            |...|:.|...|.:..:.|.|.::..::..:... ..|....|..||:|| |...:      ||.
  Fly   340 LRATFEQLKCKVEVITDATLVTIKKTVRMLQTKD-FEDKSALVLVILSHGTRHDQIAAKDDDYSL 403

Human   368 DEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPA 432
            |:.::        |..|:...|.:||||.|:|||:| :.|.. ....||..|..:|.        
  Fly   404 DDDVV--------FPILRNRTLKDKPKLIFVQACKG-DCQLG-GFMTDAAQPNGSPN-------- 450

Human   433 EADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTK 497
              :.|...:|..|:|||| .|:|:.:||:||..|.: ..:..||.:|:..|     |:|.|..:|
  Fly   451 --EILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNR-SGKTSDIDTIMMNV-----RQVVKMQSK 506

Human   498 -KQMPQPAFTLRKKLVF 513
             :|:|....||..|.||
  Fly   507 DRQIPSVTSTLTSKYVF 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CASP10NP_116759.2 DD 18..99 CDD:326335
DED_Caspase_10_r2 112..190 CDD:260074 13/58 (22%)
CASc 276..514 CDD:214521 69/248 (28%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.