DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ALA3 and CG33298

Sequence 1:NP_176191.1 Gene:ALA3 AraportID:AT1G59820 Length:1213 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1383 Identity:427/1384 (31%)
Similarity:659/1384 (48%) Gaps:283/1384 (20%)


plant     8 SVDSSAT----HQRTPSRTVTLGHI-QPQAP--------------------TYRTVYCN------ 41
            |..:|||    |.|..||:.::..: :.:||                    :||||..|      
  Fly   175 SAPTSATGGRGHSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPK 239

plant    42 ----DRESNQPVRFKGNSISTTKYNVFTFLPKGLFEQFRRIANIYFLGISCLSMTP-ISPVSPIT 101
                |..:.|   |.||.|.||||.:.:|:||.|.|||.|:||:||:.|..|:..| ||......
  Fly   240 TPKRDHPNGQ---FVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEV 301

plant   102 NVAPLSMVLLVSLIKEAFEDWKRFQNDMSINNSTVEIL--QDQQWVSIPWRKLQVGDIVKIKKDG 164
            .:.|:..||.|:.:|:.|||.:|..:|..|||:|..:.  :.:::..:.|::|:|||||.:..:.
  Fly   302 AMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNE 366

plant   165 FFPADILFMSSTNSDGICYVETANLDGETNLKIR---KALERTWDYLVPEKAYEFKGEIQCEQPN 226
            ..|||||.:.:::..|:||::|.:||||||||.|   :..|......||.|   |...::.:.|.
  Fly   367 TVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSK---FVSRVEADAPT 428

plant   227 NSLYTFTGNLV-VQKQTLPLSPDQLLLRGCSLRNTEYIVGAVVFTGHETKVMMNAMNAPSKRSTL 290
            ..||.|.|.|: ...:.:|:|.:.||||...|:||:||.|.||:.|||||.|:|......|||.:
  Fly   429 TKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQV 493

plant   291 EKKLDKLIITIFCVLVTMCLIGAIGC----SIVTDREDKYLGLHNSDWEYRNGL---MIGFFTFF 348
            |::::..:|....:|:.:|::|||||    |..|.....||.        .|.|   |...:.|:
  Fly   494 EQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVPYLP--------PNKLTANMESMWIFW 550

plant   349 TLVTLFSSIIPISLYVSIEMIKFIQSTQFINRDLNMYHAETNTPASARTSNLNEELGQVEYIFSD 413
            |.:.:...:||:||||:||:.|.:| ...|:.:::::.||||.....|..|:.|||||:::||:|
  Fly   551 TYIVILQVMIPLSLYVTIELCKILQ-VFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTD 614

plant   414 KTGTLTRNLMEFFKCSIGGVSYGCGVTEIEKGIAQRHGLKVQEEQRSTGAIREKGFNFDDPRLMR 478
            ||||||.|.|.|.:|.:.|..|....:|:|| |..:.|..      :...|.....|.|..:|.:
  Fly   615 KTGTLTENKMIFRRCVVNGSDYNHPPSELEK-IYSKPGAP------APPLIPNDNLNSDMAQLTQ 672

plant   479 GAWRNEPNPDLCKELFRCLAICHTVL----PEGD------------------------------- 508
            |.:.. |:....:|....||||:||:    |..|                               
  Fly   673 GTYLT-PHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLA 736

plant   509 ----------------------------------------------------------------- 508
                                                                             
  Fly   737 SSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSS 801

plant   509 ---------ESP------------------------EKI-------------------------- 514
                     |||                        .||                          
  Fly   802 AESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTI 866

plant   515 --------VYQAASPDEAALVTAAKNFGFFFYRRTPTMVYVRESHVEKMGKIQDVAYEILNVLEF 571
                    :|:|.||||.|||.||.::......|:|..:.|   .:...|..::  ||||.||.|
  Fly   867 YRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILV---SMPMAGATRE--YEILKVLPF 926

plant   572 NSTRKRQSVVCR-FPDGRLVLYCKGADNVIFERLA----NGMDDV-RKVTREHLEHFGSSGLRTL 630
            :|:||..|:|.| .....:|||.||||:.|...|.    |..:.: |:.|::.|:.:...|||.|
  Fly   927 DSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRIL 991

plant   631 CLAYKDLNPETYDSWNEKFIQAKSALRDREKKLDEVAELIEKDLILIGSTAIEDKLQEGVPTCIE 695
            .:|.:.||...|..|..:..:.:.:|.:||::|.:....:|.:|.|:|:|.|||:||:|||..|.
  Fly   992 VMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIA 1056

plant   696 TLSRAGIKIWVLTGDKMETAINIAYACNLINNEMKQFVISSETDAIREAEERGDQVEIARVIKEE 760
            :|..|||.:|||||||.||||||||:..|...:|:...:::.:   |:|.|......:..:..::
  Fly  1057 SLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARS---RDAAETAINFYLTDMENDK 1118

plant   761 VKREL--KKSLEEAQHSLHTVAGPKLSLVIDGKCLMYALDPSLRVML--LSLSLNCTSVVCCRVS 821
            ....|  .:||.:.|.          :||:|||.|.:.|||..:::|  |.||..|.||:|||.:
  Fly  1119 TTSTLGYGQSLRKKQR----------ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRST 1173

plant   822 PLQKAQVTSLVRKGAQKITLSIGDGANDVSMIQAAHVGIGISGMEGMQAVMASDFAIAQFRFLTD 886
            |||||.:..:|::.....||:||||||||||||.|.||:||||.||||||||:||.:.:||:|..
  Fly  1174 PLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLER 1238

plant   887 LLLVHGRWSYLRICKVVMYFFYKNLTFTLTQFWFTFRTGFSGQRFYDDWFQSLFNVVFTALPVIV 951
            |||.||.|.|.|:.::::||||||..|....||:....|||||...|..:..|:|::||:||.:.
  Fly  1239 LLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLA 1303

plant   952 LGLFEKDVSASLSKRYPELYREGIRNSFFK----WRVVAVWATSAVYQSLVCYLFVTTSSFGAVN 1012
            :|:::|.|:..|..:.|.||:.|.....::    |.::    ..|:|||||.: ||...::...:
  Fly  1304 IGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLIL----LDALYQSLVIF-FVALCAYAESD 1363

plant  1013 SSGKVFGLWDVSTMVFTCLVIAVNVRILLMSNSITRWHYITVGGSILAWLVFAFVYCGIMTPHDR 1077
                 .|:|:..|.:....:.|..|...:...|.|..|.:::..|:.::.:||.||..:......
  Fly  1364 -----VGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFG 1423

plant  1078 NENVYFVIYVLMSTFYFYFTLLLVPIVSLLGDFIFQGVERWFFPYDYQIVQEIHRHESDASKADQ 1142
            ..:.|:||:|..::...:..::|..:|::|...:...|.....|.|...|  |.:.:.:.|:.:.
  Fly  1424 VRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKV--ILQSKRERSRGEA 1486

plant  1143 LEVENELTPQEARSYAIS 1160
            |.|....:...:..|.|:
  Fly  1487 LLVTWSRSTSASSIYRIT 1504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ALA3NP_176191.1 PhoLip_ATPase_N 37..101 CDD:292826 30/75 (40%)
ATPase-Plipid 51..1129 CDD:273734 404/1273 (32%)
E1-E2_ATPase 107..>314 CDD:278548 79/213 (37%)
Cation_ATPase 500..603 CDD:289987 46/271 (17%)
R3H 656..719 CDD:294210 35/63 (56%)
HAD_like <840..888 CDD:304363 35/48 (73%)
PhoLip_ATPase_C 871..1121 CDD:292829 75/254 (30%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 26/53 (49%)
ATPase-Plipid 250..1473 CDD:273734 403/1271 (32%)
E1-E2_ATPase 302..>394 CDD:278548 33/92 (36%)
Cation_ATPase <880..965 CDD:289987 35/90 (39%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.