DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT1G54280 and CG33298

Sequence 1:NP_001319223.1 Gene:AT1G54280 AraportID:AT1G54280 Length:1240 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1388 Identity:428/1389 (31%)
Similarity:666/1389 (48%) Gaps:286/1389 (21%)


plant     3 RRRIRSRIRKSHFYTFRCLRPKTLDDQGPHVINGPGYTRIVHCNQ---------------PHLHL 52
            |...|...|....||.|    :|   :.|     |.:.|:..||.               |:..:
  Fly   184 RGHSRQASRSESIYTLR----RT---EAP-----PWWKRLTLCNYNTGDKFEERSYRTVVPNHTV 236

plant    53 ATKLIR-------YRSNYVSTTRYNLLTFLPKCLYEQFHRVANFYFLVAAILSVFP-LSPFNKWS 109
            ..|..:       :..|.:.||:|.||:|:||.|.||||||||.||:...:|:..| :|.|.|..
  Fly   237 PPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEV 301

plant   110 MIAPLVFVVGLSMGKEALEDWRRFMQDVEVNSRKASVHKGSGD-FGRRTWKRIRVGDIVRVEKDE 173
            .:.|::||:|::..|:..||.||...|..:|:....|:.|..: :.:..|:.:||||||.:..:|
  Fly   302 AMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNE 366

plant   174 FFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRCLDATLALEKDESF---QNFSGTIKCEDPN 235
            ..|||:|||.:|...|:||::|.:||||||||.:   :.....|:.:|.   ..|...::.:.|.
  Fly   367 TVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR---EVVRGFEEMQSIFVPSKFVSRVEADAPT 428

plant   236 PNLYTFVGNL-ECDGQVYPLDPNQILLRDSKLRNTAYVYGVVVFTGHDTKVMQNSTKSPSKRSRI 299
            ..||.|.|.| ...|:..|:....:|||:|:|:||.|:.|:||:.||:||.|.|::....|||::
  Fly   429 TKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQV 493

plant   300 EKRMDYIIYTLFALLLTVSFISSLGFAVMTKLLMAEWW----------YLRPDKPESLTNPTNPL 354
            |::|:..:.....:||.:..:.::|         ...|          ||.|:|   ||  .|..
  Fly   494 EQQMNIDVIWCVIILLILCVVGAIG---------CRMWLSSFTHFPVPYLPPNK---LT--ANME 544

plant   355 YAWVVHLITALLLYGYLIPISLYVSIEVVKVLQAHFINQDLQLYDSESGTPAQARTSNLNEELGQ 419
            ..|:  ..|.:::...:||:||||:||:.|:||...|:.::.|:|:|:....:.|..|:.|||||
  Fly   545 SMWI--FWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQ 607

plant   420 VDTILSDKTGTLTCNQMDFLKCSIAGTSYGVRASEVELAAAKQMA-------------------- 464
            :..|.:|||||||.|:|.|.:|.:.|:.|....||:|...:|..|                    
  Fly   608 IQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQ 672

plant   465 ----------------------------------------MDLEEKGEEVANLSMNKGRTQRYAK 489
                                                    :::::.|...|||...|   ||...
  Fly   673 GTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGK---QRQKL 734

plant   490 LASKTSSDFELETVVTASDEKDQKQNTGV---KGFSFEDNRLMN----ENWL------------- 534
            |||.||:   ..|....:....|.|...:   :.....::|.:.    .|.|             
  Fly   735 LASSTST---TTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLS 796

plant   535 -------NEPNSD---------------DILMFFRILAVCHTAIPEV----------------DE 561
                   :.|||:               .|....|..||.::.|..:                ..
  Fly   797 PISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSS 861

plant   562 DTGMC--------TYEAESPDEVAFLVASREFGFEFTKRTQSSVFIAERFSSSGQPVDREYKILN 618
            .||..        .||||||||:|.:.|:..:......|:.:.:.::...:.:    .|||:||.
  Fly   862 KTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGA----TREYEILK 922

plant   619 LLDFTSKRKRMSAIVRDEEGQ-ILLLCKGADSIIFERL---SKSGKEYL--GATSKHLNVYGEAG 677
            :|.|.|.||.||.:||....| |:|..|||||.|...|   |.:..|.:  ..|.:.|:.|...|
  Fly   923 VLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREG 987

plant   678 LRTLALGYRKLDETEYAAWNSEFHKAKTSVGADRDEMLEKVSDMMEKELILVGATAVEDKLQKGV 742
            ||.|.:..|.|:..:|..|.:...:.:.|: .:|:..|......:|..|.|:|||.:||:||.||
  Fly   988 LRILVMAKRTLNSADYTDWWARHQEIEMSL-ENRERRLRDSFAKLESNLTLLGATGIEDRLQDGV 1051

plant   743 PQCIDNLAQAGLKIWVLTGDKMETAINIGYACSLLRQGMKQISISLTNVEESSQNSEAAAKESIL 807
            |:.|.:|..||:.:|||||||.||||||.|:..|..|.|:.|.:        :..|..||:.:|.
  Fly  1052 PETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRL--------TARSRDAAETAIN 1108

plant   808 MQITNASQMIKIEKDPHAAF------------ALIIDGKTLTYAL--KDDVKYQFLALAVDCASV 858
            ..:|:      :|.|...:.            ||::||||||:.|  |..:...||.|:..||||
  Fly  1109 FYLTD------MENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASV 1167

plant   859 ICCRVSPKQKALVTRLAKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSIAQ 923
            :|||.:|.|||.:.::.||.....|||||||||||.|||.||:||||||.||||||||:||::.:
  Fly  1168 LCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPR 1232

plant   924 FRFLERLLVVHGHWCYKRIAQMICYFFYKNITFGLTLFYFECFTGFSGQSIYNDSYLLLFNVVLT 988
            ||:|||||:.||:|||.|:::||.||||||..|...:|:::.:.|||||.:.:..||:|:|::.|
  Fly  1233 FRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFT 1297

plant   989 SLPVISLGVFEQDVPSDVCLQFPALYQQGPKNLFF---DWYRILGWMGNGVYASIVIFTL----- 1045
            |||.:::||:::.|..|:.|:.|.||:.|...:.:   |::.||   .:.:|.|:|||.:     
  Fly  1298 SLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLIL---LDALYQSLVIFFVALCAY 1359

plant  1046 ---NLGIFHVQSFRSDGQTADMNAMGTAMFTCIIWAVNVQIALTMSHFTWIQHVMIWGSIGAWYV 1107
               ::||:.               .||.:....::|..|..|:.:..:|.:..:.|..|:|::|:
  Fly  1360 AESDVGIWE---------------FGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYL 1409

plant  1108 FLALYGMLPVKLSG-NIFHMLVEILAPAPIFWLTSLLVIAATTLPYLFHISYQRSVNPLDHH--I 1169
            |..:|..:.:...| ...:.::.:...:.:.||..:|......||.|...:.:.|:.|.|..  |
  Fly  1410 FAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVI 1474

plant  1170 IQEIKHFRIDVEDERMWKREKSK 1192
            :|.              |||:|:
  Fly  1475 LQS--------------KRERSR 1483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT1G54280NP_001319223.1 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 408/1285 (32%)
E1-E2_ATPase 302..>394 CDD:278548 35/92 (38%)
Cation_ATPase <880..965 CDD:289987 32/89 (36%)
HAD_like <1177..1240 CDD:304363 42/63 (67%)
PhoLip_ATPase_C 1223..1468 CDD:292829 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.