DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: UXT and Uxt

Sequence 1:NP_705582.1 Gene:UXT HGNCID:12641 Length:169 Species:Homo sapiens
Sequence 2:NP_001260464.1 Gene:Uxt FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster

Alignment Length:134 Identity:38/135 (28%)
Similarity:73/135 (54%) Gaps:0/135 (0%)


Human    23 EATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGC 87
            :|...::.:.|.||::||:.|||::.....:..|::.:|:||:|.::............||::|.
  Fly    18 DANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGS 82

Human    88 NFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE 152
            |.|:...|.....|.|.:|...||::::.:|.:|.|.:..:||:.|:.|..:|:..:|.|.|.|.
  Fly    83 NVFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALI 147

Human   153 GLRE 156
            .:.|
  Fly   148 AISE 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UXTNP_705582.1 Prefoldin_alpha 30..159 CDD:238327 37/128 (29%)
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3047
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5258
Isobase 1 0.950 0 Normalized mean entropy S6280
OMA 1 1.010
OrthoDB 1 1.010 D1559312at2759
OrthoFinder 1 1.000 FOG0006103
OrthoInspector 1 1.000 T1074278
orthoMCL 1 0.900 OOG5_129956
Panther 1 1.100 LDO PTHR13345
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5483
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.820

Return to query results.
Submit another query.