DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SOX14 and Sox100B

Sequence 1:NP_004180.1 Gene:SOX14 HGNCID:11193 Length:240 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster

Alignment Length:242 Identity:79/243 (33%)
Similarity:117/243 (48%) Gaps:41/243 (17%)


Human     3 KPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQ 67
            :..:||||||||||||::..||.|:::.|.:.|||:||.||..||.|.:::|:|:::.|::||..
  Fly    72 RKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMT 136

Human    68 HMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKA-RAFLPP 131
            |.:|||||||:||||...:|                |.:.:|  .|.|.|    ||.. .|.:..
  Fly   137 HKQEHPDYKYQPRRKKARVL----------------PSQQSG--EGGSPG----PEMTLSATMGS 179

Human   132 ASAPYSLLDPAQ---FSSSAIQKMGEVPHTLATGALPYASTLGYQNGAF-GSLSCPSQHTHTHPS 192
            :..|.|.....|   ...:|...:|....|::...:...|:..:.|.|| .||:.....:....|
  Fly   180 SGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQS 244

Human   193 PTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATA 239
            ....|...||: ||.|.|:|.||..             ||:.|.:.|
  Fly   245 LIETGLDSPCS-TASSMSSLTPPAT-------------PYNVAPSNA 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SOX14NP_004180.1 SOX-TCF_HMG-box 7..78 CDD:238684 39/71 (55%)
SOXp 77..>117 CDD:315092 10/40 (25%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.