DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC25A11 and CG1907

Sequence 1:XP_024306762.1 Gene:SLC25A11 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:347 Identity:183/348 (53%)
Similarity:223/348 (64%) Gaps:45/348 (13%)


Human     1 MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSF 65
            |:||:...|    .|...:..::|||||||:|||||:.||||||||.|||:||.|:..:||::|.
  Fly     1 MSATSVQEA----PKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSL 61

Human    66 HALTSILKAEGLRGIYTGYWGLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIY 130
            |.:.:|:..||...:|.|                            :.|.|||||||||.|||:|
  Fly    62 HCIQTIVSKEGPLALYQG----------------------------IGAALLRQATYTTGRLGMY 98

Human   131 TVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNA 195
            |.|.:.........||......:|..|||.|||:||||||||:|||:|||||..:||.|.||.||
  Fly    99 TYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANA 163

Human   196 LIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYF-------SDNILCHFCA 253
            |.|||||||:..||||.:||:.||:|||..|||||||.|.      ||       .:.|..||||
  Fly   164 LARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKT------YFRHGPLQMEEGIKLHFCA 222

Human   254 SMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLG 318
            ||:|||:||..|||:||||||||||:|:||||||:...|||.:|.|.||.|:|||||||||.|||
  Fly   223 SMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLG 287

Human   319 PHTVLTFIFLEQMNKAYKRLFL 340
            ||||||||.|||:|:.|.:..|
  Fly   288 PHTVLTFIILEQLNQGYNKYVL 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 35/61 (57%)
Mito_carr 144..241 CDD:278578 59/97 (61%)
Mito_carr 243..337 CDD:278578 66/101 (65%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 51/121 (42%)
Mito_carr 118..207 CDD:278578 59/95 (62%)
Mito_carr 219..307 CDD:278578 64/88 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293136553
eggNOG 1 0.900 E1_KOG0759
Hieranoid 1 1.000
Homologene 1 1.000 H2637
Inparanoid 1 1.050 356 1.000 Inparanoid score I2200
Isobase 1 0.950 0 Normalized mean entropy S777
OMA 1 1.010
OrthoDB 1 1.010 D404074at33208
OrthoFinder 1 1.000 FOG0004492
OrthoInspector 1 1.000 T1073730
orthoMCL 1 0.900 OOG5_127710
Panther 1 1.100 LDO PTHR45618
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R857
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.