DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PEX6 and Pex6

Sequence 1:NP_171799.2 Gene:PEX6 AraportID:AT1G03000 Length:941 Species:Arabidopsis thaliana
Sequence 2:NP_001027403.2 Gene:Pex6 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster

Alignment Length:889 Identity:264/890 (30%)
Similarity:412/890 (46%) Gaps:205/890 (23%)


plant   120 EDASLTQVPVSDSL----HTML--VFPTYDLMGQQLLDQEVAYLSPMLAFNLSLHISCLKSLVHR 178
            ::.::||..:...|    ||::  :.|........|..||..|                      
  Fly   142 DEGNMTQTVIKQMLQEAPHTIVAQILPAAQCQPNCLYVQENFY---------------------- 184

plant   179 GNGVLEKY-FEAKC--------DEEFIGKSAEDGSKIGLDLEPVSQVPGYASHLRVSFVKIPECG 234
            || :|::: ..:.|        ||:                    .:||.|:...|..|..|.  
  Fly   185 GN-ILDRFQIRSNCWVQVEHFADEQ--------------------TIPGIATKAHVYLVADPH-- 226

plant   235 TIPSLKVNSSFEAEERQGLIDSALQKYFGTDRQLSRGDIFRIYIDWNCGSSICNPCSQR---LCS 296
                     ...||    |.:..|..||.|.|.:.||..:||.::    :.:....:..   |..
  Fly   227 ---------ELPAE----LTEVILSNYFNTPRLMHRGHTYRIEVN----AELVGTATYAHYYLIF 274

plant   297 ESDDYIYFKVIAMEPSNERF---------------LRVNHS------QTALVLGGTVSSGLPPDL 340
            ....:::.|.|.:|.....|               :..:||      ..::.:.....|||....
  Fly   275 AHLRHVHLKCIHLETKGSEFELQAIVAKNFSNLVQVPASHSFLPRQVLDSMAIVENYPSGLRKPY 339

plant   341 LVYRSKVPMPLQEETVNILASVLSPPLCPSALASKLRVAVLLHGIPGCGKRTVVKYVARRLGLHV 405
            .:.||.|...|.:::..:.:..:.|             ..||.|..|.||..:|..||:.||:|:
  Fly   340 KLLRSSVDAFLPKKSACLSSKHIFP-------------VFLLQGERGSGKSKLVSAVAQELGMHI 391

plant   406 VEFSCHSLLASSERKTSTALAQTFNMARRYSPTILLLRHFDVF--KNLGSQDGSLGDRVGVSFEI 468
            ....|..:::.....|...|...|..::...|.::...:|::|  .|.|::|          ..:
  Fly   392 YGADCAEIVSQVPSHTEMKLKAVFAKSQVCEPLMICFHNFEIFGIDNEGNED----------LRL 446

plant   469 ASVIRELTEPVSNGDSSMEEKSNSNFSENEVGKFRGHQVLLIASAESTEGISPTIRRCFSHEIRM 533
            .|......:.:.|.|                   |.|.::::| ..|...:.|.|:..|...|.:
  Fly   447 LSAFHVQVQELFNRD-------------------RKHPIVVVA-LTSDRHLKPMIQGLFLEIINI 491

plant   534 GSLNDEQRSEML---------------SQSLQGVSQFLNISSDEFM--------------KGLVG 569
            ...:.|:|.|:|               .::::.:..|...:..:||              :.:..
  Fly   492 DMPSKEERFEILRWMHVRETFNDIIYNQKAIEQLPLFSRENQSQFMPRISPSWRETLNVLQDVAA 556

plant   570 QTSGFLPRDLQALVADAGANLYISQESETKKINSLSDDLHGVDIHQASQIDNSTEKLTAKEDFTK 634
            ::.|||..|||.|..:|                        |.:...:::..:|..::   .|.|
  Fly   557 KSQGFLLGDLQLLYDNA------------------------VRMKIRNRLGRTTLDMS---HFAK 594

plant   635 ALDRSKKRNASALGAPKVPNVKWDDVGGLEDVKTSILDTVQLPLLHKDLFSSGLRKRSGVLLYGP 699
            .|...:...|.:|||||||.|.|.|:|||..:|..|..::.|||.|..|....|| |||:|||||
  Fly   595 NLTDMQSSFADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPLKHVHLMGKNLR-RSGILLYGP 658

plant   700 PGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAP 764
            |||||||:||||||||:|:||||:||||:|||:|:||:|||::|.:||||.|||:|.||||||||
  Fly   659 PGTGKTLVAKAVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSAAPCVLFLDELDSLAP 723

plant   765 ARGASGDSGGVMDRVVSQMLAEIDGLS--DSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGV 827
            .||.:|||||||||||||:|||:||:|  |:|:.:||:.|:|||||||||||||||||||.|||.
  Fly   724 NRGVAGDSGGVMDRVVSQLLAEMDGMSDGDTSKPIFILAATNRPDLIDPALLRPGRFDKLFYVGP 788

plant   828 NADASYRERVLKALTRKFKLSEDVSLYSVAKKCPSTFTGADMYALCADAWFQAAKRKVSKSDSGD 892
            .:.|..:..||:|.|::|.|...|.:..:|::..|..:|||:|::|::||..|.:|.:....||.
  Fly   789 CSTAEDKAAVLRAQTQRFALDAGVDMEQIAERLKSEMSGADLYSICSNAWLSAVRRTIDGHLSGT 853

plant   893 MPTEEDDPDSVVVEYVDFIKAMDQLSPSLSITELKKYEMLRDQF 936
            :..:|..|::|:|:..||.|:.::..||:|..:|:.:..|:..:
  Fly   854 ISEKELVPENVIVQEEDFTKSFNKFVPSISAKDLEYFNNLKASY 897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PEX6NP_171799.2 SpoVK 348..928 CDD:223540 216/613 (35%)
AAA 380..534 CDD:278434 33/156 (21%)
P-loop_NTPase 624..>759 CDD:304359 78/135 (58%)
AAA 694..827 CDD:278434 103/135 (76%)
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 201/538 (37%)
P-loop_NTPase 367..492 CDD:304359 33/155 (21%)
AAA 653..787 CDD:278434 102/134 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I585
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D233419at2759
OrthoInspector 1 1.000 T193569
orthoMCL 1 0.900 OOG5_129222
Panther 1 1.100 LDO PTHR23077
Phylome 1 0.910 0.667 Consistency score
65.970

Return to query results.
Submit another query.