DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACA.l and CG33298

Sequence 1:NP_172780.1 Gene:ACA.l AraportID:AT1G13210 Length:1203 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1412 Identity:426/1413 (30%)
Similarity:654/1413 (46%) Gaps:349/1413 (25%)


plant    34 PGFSRVVYCN---------------------EPNSPAAERRN--YVGNYVRSTKYTLASFIPKSL 75
            |.:.|:..||                     .|.:|..:..|  :|||.:|:|||||.|||||:|
  Fly   206 PWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNL 270

plant    76 FEQFRRVANFYFLVTGVLS-LTALSPYSPISALLPLTFVIAASMVKEAIEDWGRKKQDIEMNNRK 139
            .|||.||||.||:...:|: :..:|.:....|::|:.||:..:.||:..||..|:..|..:||..
  Fly   271 LEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTT 335

plant   140 VKVHDG-NGIFRREGWRDLKVGNIVRVEKDEFFPADLLLLSSSYEDSICYVETMNLDGETNLKVK 203
            .:|:|| ...:::..|::|:||:||.:..:|..|||:|||.:|....:||::|.:||||||||.:
  Fly   336 CRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR 400

plant   204 QGLEATSSALHEDSDFKELKAV---------VKCEDPNADLYTFVGTL-HFEEQRLPLSITQLLL 258
            :.:..          |:|::::         |:.:.|...||.|.|.| |...:|:|:|...|||
  Fly   401 EVVRG----------FEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLL 455

plant   259 RDSKLRNTEYIYGVVVFTGHDTKVIQNSTDPPSKRSRIERKMDKIIYLMFGVVFLMSFIGSIVFG 323
            |:|:|:||:||.|:||:.||:||.:.|::.|..|||::|::|:..:.....::.::..:|:|   
  Fly   456 RESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAI--- 517

plant   324 IETREDRVRNGGRTERW----------YLRPDNADIFFDPDRAPMAAVYHFFTAVMLYSYFIPIS 378
                      |.|  .|          ||.|:..       .|.|.:::.|:|.:::....||:|
  Fly   518 ----------GCR--MWLSSFTHFPVPYLPPNKL-------TANMESMWIFWTYIVILQVMIPLS 563

plant   379 LYVSIEIVKVLQSLFINNDILMYYEENDKPAHARTSNLNEELGMVDTILSDKTGTLTCNSMEFIK 443
            |||:||:.|:||...|:|::.::..|.:|....|..|:.||||.:..|.:|||||||.|.|.|.:
  Fly   564 LYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRR 628

plant   444 CSIAGTAYGRGITEVERSMAMRSNGSSLVGDDLDVVVDQSG----PKIKGFNFLDE--RVMKGNW 502
            |.:.|:.|....:|:|:                  :..:.|    |.|...|...:  ::.:|.:
  Fly   629 CVVNGSDYNHPPSELEK------------------IYSKPGAPAPPLIPNDNLNSDMAQLTQGTY 675

plant   503 VKQRDAAVLQKFFRLLAVCHTAI----PETD---------------------------------- 529
            :... |..:|:|..:||:|:|.|    |..|                                  
  Fly   676 LTPH-AQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASST 739

plant   530 ----------------------------------------------------------------- 529
                                                                             
  Fly   740 STTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAES 804

plant   530 ----------------------------------------------------------------E 530
                                                                            .
  Fly   805 SPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRT 869

plant   531 ATGSVSYEAESPDEAAFVVAAREFGFEFFSRTQNGISFRELDLAS----GKTVERVYRLLNVLEF 591
            |.|...||||||||.|.|.||..:.....:|:.|.|      |.|    |.|  |.|.:|.||.|
  Fly   870 ADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQI------LVSMPMAGAT--REYEILKVLPF 926

plant   592 NSARKRMSVIVRDEDGR-LLLLSKGADNVMFERLAKNGRK-----FEEKTREHVNEYADAGLRTL 650
            :|:||.||::||....: ::|.:||||:.:...|......     ..|:|::.::.||..|||.|
  Fly   927 DSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRIL 991

plant   651 ILAYREVDENEYIEFSKNFNEAKNSVTADRESLIDEITEQMERDLILLGATAVEDKLQNGVPDCI 715
            ::|.|.::..:|.::.....|.:.|: .:||..:.:...::|.:|.|||||.:||:||:|||:.|
  Fly   992 VMAKRTLNSADYTDWWARHQEIEMSL-ENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETI 1055

plant   716 DKLAQAGIKIWVLTGDKMETAINIGFACSLLRQEMKQIIINLETPHIKALEKAGEKDAIEHASRE 780
            ..|..|||.:|||||||.||||||.::..|..|:|:.|.:.           |..:||.|.|. .
  Fly  1056 ASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLT-----------ARSRDAAETAI-N 1108

plant   781 SVVNQMEEGKALLTASSSAS-SHEAFALIIDGKSLTYALEDDFKKK----FLDLATGCASVICCR 840
            ..:..||..|...|.....| ..:..||::|||:||:.|  |.|.|    ||.|:..||||:|||
  Fly  1109 FYLTDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFIL--DPKSKLILPFLRLSKRCASVLCCR 1171

plant   841 SSPKQKALVTRLVKSGTGKTTLAIGDGANDVGMLQEADIGVGISGVEGMQAVMSSDIAIAQFRYL 905
            |:|.|||.:.::||......|||||||||||.|:|.||:||||||.|||||||::|..:.:||||
  Fly  1172 STPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYL 1236

plant   906 ERLLLVHGHWCYSRISSMICYFFYKNITFGVTVFLYEAYTSFSAQPAYNDWFLSLFNVFFSSLPV 970
            |||||.||:|||.|:|.||.||||||..|...:|.|:.|..||.|...:..:|.|:|:.|:|||.
  Fly  1237 ERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPP 1301

plant   971 IALGVFDQDVSARYCYKFPLLYQEGVQNLLFSWKRIIGW--MFNGVFTALAIFF--LCKESLKHQ 1031
            :|:||:|:.|:.....|.|.||:.|  .|..:::....|  :.:.::.:|.|||  ||       
  Fly  1302 LAIGVYDKRVAEDLLLKNPYLYKNG--RLGVAYRPHDFWLILLDALYQSLVIFFVALC------- 1357

plant  1032 LYNPNGKTAGREILG----GTMYTCVVWVVNL-QMALAISYFTWLQHIVIWGSVAFWYIFLMIYG 1091
                   ......:|    ||..|......|| ..|:.|..:|.|..:.|..|:..:|:|.::|.
  Fly  1358 -------AYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYD 1415

plant  1092 AITPS-FST-DAYKVFIEALAPAPSYWLTTLFVMFFALIPFFVFKSVQMRFFPGYHQMIQWIRYE 1154
            ::..: |.. .:|.|.....|.| .:||..:.....|::|..:..:|::...|            
  Fly  1416 SVCMNCFGVRSSYWVIFVCFASA-VHWLVIMLSTVVAVLPRLLLTTVRISLCP------------ 1467

plant  1155 GHSNDPEFVEMVRQRSIRPTTVGFTARRAASVRRSGRFHDQLNKNFI 1201
             ..:....::..|:|| |...:..|..|:.|.....|..|..:||.|
  Fly  1468 -DDSTKVILQSKRERS-RGEALLVTWSRSTSASSIYRITDYGSKNQI 1512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACA.lNP_172780.1 PhoLip_ATPase_N 39..105 CDD:292826 31/90 (34%)
ATPase-Plipid 55..1149 CDD:273734 407/1315 (31%)
Cation_ATPase 520..623 CDD:289987 44/275 (16%)
COG4087 <841..899 CDD:226572 36/58 (62%)
PhoLip_ATPase_C 892..1142 CDD:292829 84/261 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 26/50 (52%)
ATPase-Plipid 250..1473 CDD:273734 407/1327 (31%)
E1-E2_ATPase 302..>394 CDD:278548 35/92 (38%)
Cation_ATPase <880..965 CDD:289987 34/93 (37%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 85/275 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.