powered by:
                   
 
    
    
             
          
            Protein Alignment H2BC21 and His2B:CG33884
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_003519.1 | Gene: | H2BC21 / 8349 | HGNCID: | 4760 | Length: | 126 | Species: | Homo sapiens | 
          
            | Sequence 2: | NP_001027345.1 | Gene: | His2B:CG33884 / 3772575 | FlyBaseID: | FBgn0053884 | Length: | 123 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 129 | Identity: | 105/129 - (81%) | 
          
            | Similarity: | 108/129 -  (83%) | Gaps: | 9/129 - (6%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
Human     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGI 62|| |..|..|.||..     ||||   |..||:||.|||||:||:||||||||||||||||||.|
 Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
 
 
Human    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126|||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
 Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 1 | 1.000 | 143 | 1.000 | Domainoid score | I4650 | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_KOG1744 | 
          
            | Hieranoid | 1 | 1.000 | - | - |  |  | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 191 | 1.000 | Inparanoid score | I3871 | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 1 | 1.010 | - | - |  | QHG53922 | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000065 | 
          
            | OrthoInspector | 1 | 1.000 | - | - |  | otm40568 | 
          
            | orthoMCL | 1 | 0.900 | - | - |  | OOG6_100082 | 
          
            | Panther | 1 | 1.100 | - | - | LDO | PTHR23428 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2558 | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X77 | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            | User_Submission | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 12 | 11.900 |  | 
        
      
           
             Return to query results.
             Submit another query.