DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIST2H2BE and His2B:CG33884

DIOPT Version :8

Sequence 1:NP_003519.1 Gene:HIST2H2BE / 8349 HGNCID:4760 Length:126 Species:Homo sapiens
Sequence 2:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster

Alignment Length:129 Identity:105/130 (81%)
Similarity:108/130 (83%) Gaps:9/130 (7%)


Human     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGI 62
            || |..|..|.||..     ||||   |..||:||.|||||:||:||||||||||||||||||.|
  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59

Human    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HIST2H2BENP_003519.1 H2B 28..124 CDD:197718 90/96 (94%)
His2B:CG33884NP_001027345.1 H2B 33..121 CDD:197718 84/88 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3808
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1536672at2759
OrthoFinder 1 1.000 FOG0000014
OrthoInspector 1 1.000 T608726
orthoMCL 1 0.900 OOG5_126572
Panther 1 1.100 O PTHR23428
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2558
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.