powered by:
Protein Alignment H2BC21 and His2B:CG33874
DIOPT Version :9
| Sequence 1: | NP_003519.1 |
Gene: | H2BC21 / 8349 |
HGNCID: | 4760 |
Length: | 126 |
Species: | Homo sapiens |
| Sequence 2: | NP_001027370.1 |
Gene: | His2B:CG33874 / 3772264 |
FlyBaseID: | FBgn0053874 |
Length: | 123 |
Species: | Drosophila melanogaster |
| Alignment Length: | 129 |
Identity: | 105/129 - (81%) |
| Similarity: | 108/129 - (83%) |
Gaps: | 9/129 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Human 1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGI 62
|| |..|..|.||.. |||| |..||:||.|||||:||:||||||||||||||||||.|
Fly 1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
Human 63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126
|||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Fly 60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
143 |
1.000 |
Domainoid score |
I4650 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1744 |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
191 |
1.000 |
Inparanoid score |
I3871 |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
1 |
1.010 |
- |
- |
|
QHG53922 |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000065 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
otm40568 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100082 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23428 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2558 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X77 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
12 | 11.900 |
|
Return to query results.
Submit another query.