DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIST2H2BE and His2B:CG33908

DIOPT Version :8

Sequence 1:NP_003519.1 Gene:HIST2H2BE / 8349 HGNCID:4760 Length:126 Species:Homo sapiens
Sequence 2:NP_001027287.1 Gene:His2B:CG33908 / 3772099 FlyBaseID:FBgn0053908 Length:123 Species:Drosophila melanogaster

Alignment Length:129 Identity:105/130 (81%)
Similarity:108/130 (83%) Gaps:9/130 (7%)


Human     1 MPEPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGI 62
            || |..|..|.||..     ||||   |..||:||.|||||:||:||||||||||||||||||.|
  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59

Human    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HIST2H2BENP_003519.1 H2B 28..124 CDD:197718 90/96 (94%)
His2B:CG33908NP_001027287.1 H2B 33..121 CDD:197718 84/88 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126572
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.