DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CARS and CysRS

Sequence 1:XP_024304469.1 Gene:CARS HGNCID:1493 Length:867 Species:Homo sapiens
Sequence 2:NP_611087.1 Gene:CysRS FlyBaseID:FBgn0027091 Length:741 Species:Drosophila melanogaster

Alignment Length:774 Identity:439/775 (57%)
Similarity:530/775 (68%) Gaps:51/775 (7%)


Human    95 RRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDI 159
            :|.||.|..|......:|.|:|||||.||.|:|.||..||||.||||||||||||||||||||||
  Fly     3 KRGQPAWQAPEAVDRPKLKLFNSLTRQKEDFVPLDGNNVTWYSCGPTVYDASHMGHARSYISFDI 67

Human   160 LRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQY---REKRPEAAQLLEDVQAALKPFSV 221
            |||:|.|||.:::.|.|||||||||||:||||||||::|   .:|.| ..:||...:..|:.|..
  Fly    68 LRRILSDYFGYNIHYVMNITDIDDKIIRRARQNHLFDEYAAEAQKLP-LDELLGQQKEVLQRFQD 131

Human   222 KLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLG 286
            ...:.||||||.||::....:..|.|.|.||| .:....|::....:.|.||||.:||||||..|
  Fly   132 TCAKNTDPDKKIMLDKTLQRMNDAVEALTKAV-GKGDEREISEKRLLYLNEAKDPISDWLDSLKG 195

Human   287 CDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSV 351
            ..:.||::|..||::||..||.||::||:||||||||||||||:||.|:|||:|||..|.:|.||
  Fly   196 AQINDNAVFEALPRYWEDQFHNDMKSLNILPPDVLTRVSEYVPQIVTFIQKIIDNGLAYAANNSV 260

Human   352 YFDTAKFASSEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSW 416
            |||...|...|||.|.||||||.||.|:||||||||||:.||||||||.||||||||||.|||.|
  Fly   261 YFDVNGFDKREKHHYAKLVPEAYGDTKSLQEGEGDLSIAEDRLSEKRSANDFALWKASKAGEPWW 325

Human   417 PCPWGKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTG 481
            ..|||||||||||||||||..:.|.:.|||.||.||:|||||||||||||.|....||:||||||
  Fly   326 DSPWGKGRPGWHIECSAMASDIFGPTFDIHTGGVDLKFPHHDNELAQSEAAFNESEWVKYFLHTG 390

Human   482 HLTIAGCKMSKSLKNFITIKDALKKHSGIHWLLPQTPQPPSHTCVMAVALGRIRALAVLCPPTAR 546
            ||||||||||||||||:||::||||||                                    |.
  Fly   391 HLTIAGCKMSKSLKNFVTIQEALKKHS------------------------------------AT 419

Human   547 QLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPV--DITGQFEKWGEEEAEL 609
            |||||||:||||||||||.||||.|.|||||||||||||||:.|..:  :...||:.|.|.||.|
  Fly   420 QLRLAFLLHSWKDTLDYSENTMEMATQYEKFLNEFFLNVKDLTRHVLSEEPRRQFDAWTEVEAAL 484

Human   610 NKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALYLTHML 674
            .|.|.:.:..:|.:||||:|||:.::.:|.|||..|:|:...|.   |.|..||.|:|.|:|.:|
  Fly   485 QKKFSNAQVQVHASLCDNIDTRSALDAIRELVSVSNVYIRDNKT---RLNSLLLRNVATYITDLL 546

Human   675 KIFGAVE-EDSSLGFPV-GGPGTSLS---LEATVMPYLQVLSEFREGVRKIAREQKVPEILQLSD 734
            .:|||:. ....:|||| ||.|...:   ||.||:||:|.|:|||..||:.|:..|..:||:|.|
  Fly   547 HVFGAISGPRGGIGFPVSGGSGAQAAGADLETTVLPYVQSLAEFRYLVREQAKTLKAFDILKLCD 611

Human   735 ALRDNILPELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVEEEKRKKKEEAARRKQEQEAAKL 799
            .||||:||.||||.||.:.....||||||::||:|||.|...|.||..:||...:...|..|||.
  Fly   612 DLRDNVLPNLGVRLEDKDIGKYAVKLVDRDSLLREREAKLAAEAEKAAEKERKKQAAAEAAAAKE 676

Human   800 AKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYL 858
            |:.::.|.||||:||:|||.||||||||||.||||:||||.|||:||.:.||:.|.|||
  Fly   677 AQRRVNPKEMFLAETEKYSAFDENGLPTHDKEGKEVSKGQIKKLQKLQQQQEQRYNEYL 735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CARSXP_024304469.1 GST_C_CysRS_N 3..76 CDD:198343
PTZ00399 91..858 CDD:240402 438/773 (57%)
CysRSNP_611087.1 PTZ00399 2..737 CDD:240402 439/775 (57%)
CysRS_core 21..437 CDD:173899 276/454 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136025295
eggNOG 1 0.900 E1_COG0215
Hieranoid 1 1.000
Homologene 1 1.000 H1328
Inparanoid 1 1.050 852 1.000 Inparanoid score I426
Isobase 1 0.950 0 Normalized mean entropy S696
OMA 1 1.010
OrthoDB 1 1.010 D480663at33208
OrthoFinder 1 1.000 FOG0004329
OrthoInspector 1 1.000 T1073101
orthoMCL 1 0.900 OOG5_126755
Panther 1 1.100 LDO PTHR10890
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1431
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.