DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CARS and CysRS-m

Sequence 1:XP_024304469.1 Gene:CARS HGNCID:1493 Length:867 Species:Homo sapiens
Sequence 2:NP_001286405.1 Gene:CysRS-m FlyBaseID:FBgn0033900 Length:558 Species:Drosophila melanogaster

Alignment Length:687 Identity:206/688 (30%)
Similarity:303/688 (44%) Gaps:193/688 (28%)


Human    87 CRLQASKGRRVQP---QWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHM 148
            ||...|:....|.   :|..|.| |...:::||...|.|...|.::.:.||||.|||||||::|:
  Fly    21 CRRNISEEAPKQDSPFKWRKPIG-QHTGINIYNHGLRQKVPLILRNPQMVTWYTCGPTVYDSAHL 84

Human   149 GHARSYISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQ 213
            |||.:|:..|||:|:|:||||.::...|||||:||||||||                        
  Fly    85 GHASTYVKVDILQRILRDYFKINLVTAMNITDVDDKIIKRA------------------------ 125

Human   214 AALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLS 278
                                                      :|.|                  .
  Fly   126 ------------------------------------------QLAG------------------L 130

Human   279 DWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGY 343
            ||               .|:.:.:|.:|.:||..|||..|||.:.|:..:|.|:.|:|:::|...
  Fly   131 DW---------------QKMARAYEAEFRQDMLRLNVQAPDVRSHVTTTMPVIIQFIQQLIDGKQ 180

Human   344 GYVS-NGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSE-KRSPNDFALW 406
            .||: :.|||||.:|     ..:||||               .:|.:|.|:|.. ||:..|||||
  Fly   181 AYVTPDNSVYFDVSK-----SKNYGKL---------------QNLGLSEDKLDPIKRNTADFALW 225

Human   407 KASKPG-EPSWPCPW-GKGRPGWHIECSAMAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFE 469
            ||.|.| ||:|..|| |:|||||||||||:||...|..:|||.||.|||||||:||.||..|.::
  Fly   226 KARKSGSEPTWAAPWGGEGRPGWHIECSAIAGLFFGRQLDIHAGGLDLRFPHHENEEAQCCARYK 290

Human   470 NDCWVRYFLHTGHLTIAGC--KMSKSLKNFITIKDALKKHSGIHWLLPQTPQPPSHTCVMAVALG 532
            .|.||.|::|||.|.:.|.  ||||||.|.|::.:.|||:                         
  Fly   291 TDQWVNYWVHTGQLHMVGDREKMSKSLGNTISVSELLKKY------------------------- 330

Human   533 RIRALAVLCPPTARQLRLAFLMHSWKDTLDYSSNTMESALQ-YEKFLNEFFLNVKDILRAPVDIT 596
                       ||.:.|:|.|:.::::.:.||...|.:|.| .::|.|         .:|.:...
  Fly   331 -----------TADEFRMACLLSNYRNAMPYSDQLMVTARQTLQRFRN---------FQADLSAY 375

Human   597 GQFEKWGE--EEAELNKNFYDKKTAIHKALCDNVDTR---TVMEEMRALVSQCNLYMAARKAVRK 656
            .||.|...  :|..|........|.....|.|:.||.   :|:.:..:.:|:|    ...:.|..
  Fly   376 TQFLKPVHLLDEGALKAQLTHTVTEFDNCLRDDFDTARAISVLIDQMSSISRC----INEQQVDA 436

Human   657 RPNQALLENIAL----YLTHMLKIFG--AVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFRE 715
            :...|...::.|    ::...:..||  .:::..||...|.....|:.....|...:.|....||
  Fly   437 QEEPAYCIDLLLAAGNFINRAIVTFGLSELQDKESLQEKVSFTDHSIDPNLLVNDVINVRGRMRE 501

Human   716 GVRKIAREQKVPEILQLSDALRDNILPELGVRFEDHE 752
              |..:...|.|::|...|.|| ::|.:.|::..||:
  Fly   502 --RATSGNVKNPQLLAACDELR-SLLQQHGIQVRDHK 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CARSXP_024304469.1 GST_C_CysRS_N 3..76 CDD:198343
PTZ00399 91..858 CDD:240402 204/684 (30%)
CysRS-mNP_001286405.1 CysRS_core 49..351 CDD:173899 154/457 (34%)
CysS 50..540 CDD:223293 198/658 (30%)
DALR_2 400..454 CDD:214848 10/58 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D480663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126755
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.