DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SFP2 and CG33282

Sequence 1:NP_001330511.1 Gene:SFP2 AraportID:AT5G27360 Length:526 Species:Arabidopsis thaliana
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:474 Identity:123/475 (26%)
Similarity:204/475 (43%) Gaps:42/475 (9%)


plant    61 IEERLLQLKNQNDDSECRITACVILSTFIAVCGSFSFGVSLGYTSGAEIGIMK-----DLDLSIA 120
            ::..|||.|          |...:|:|.|....:|..||.:|:.|.....|..     |.::::|
  Fly     5 LKNSLLQQK----------TRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLA 59

plant   121 QFSAFASLSTLGAAIGALFSGKMAIILGRRKTMWV--SDLLCIIGWFSIAFAKDVMWLNFGRISS 183
            |.|...|:..|.:..|.|....:....||:..:::  ....||  |..|..|.:|.:|...|...
  Fly    60 QISWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACI--WILIYCASNVYYLYAARFLC 122

plant   184 GIGLGLISYVVPVYIAEISPKHVRGTFTFTNQLLQNSGLAMVYFSGNFLNWRILALLGALPCFIQ 248
            |...|....|||::|:|::..::||..|....|..:.|:...|....:|.:.::..|..:.....
  Fly   123 GFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAY 187

plant   249 VIGLFFVPESPRWLAKVGSDKELENSLLRLRGGNADISREASDIE-------VMTKMVENDSKSS 306
            .|....:||:..:|.|.......|||....|...:.|..:.|.:.       |:::...|.:..|
  Fly   188 FIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLS 252

plant   307 FCDLFQRKYRYTLVVGIGLMLIQQFSGSSAVLSYASTILRKAGFSVTIGST--LLGLFMIPKAMI 369
            :.||..:.........|.|.|..||||..:.::|.|.|.:.:|..|.:.:.  ::||..|.....
  Fly   253 YKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYT 317

plant   370 GVILVDKWGRRPLLLTSVSGMCITSMLIGVAFTLQKMQLLPELT--PVFTFICVTLYIGTYAIGL 432
            ..||||..|||.|:|.|..|:.|..:..|....|.|:..|.:..  |:...| :..|:..  |||
  Fly   318 STILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMI-IICYVAN--IGL 379

plant   433 GGLPWVIMSEIFPMNIKVTAGSIVTLVSWSSSSIVTYA----FNFLLE-WSTQGTFYVFGAVGGL 492
            .|:.::::.|:||:.|:    |:.|.:|....|::.:.    |..:|. |....|.:...|...|
  Fly   380 IGIFFLVLVELFPVKIR----SLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALL 440

plant   493 ALLFIWLLVPETKGLSLEE 511
            ...:.||.:.||||.|:.|
  Fly   441 TFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SFP2NP_001330511.1 None
CG33282NP_001097067.1 MFS 21..448 CDD:119392 111/436 (25%)
MFS_1 53..409 CDD:284993 95/365 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23500
Phylome 1 0.910 0.932 Consistency score
33.020

Return to query results.
Submit another query.