DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FZD6 and fz2

Sequence 1:NP_001158087.1 Gene:FZD6 HGNCID:4044 Length:706 Species:Homo sapiens
Sequence 2:NP_001262037.1 Gene:fz2 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster

Alignment Length:705 Identity:213/706 (30%)
Similarity:316/706 (45%) Gaps:163/706 (23%)


Human    13 LPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFL 77
            :|::.......||.||:|.|..:.||||.|||.|.|..|..|.:|:..|.||..::|||:::.||
  Fly    53 VPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFL 117

Human    78 CKAFVPTCIEQIH-VVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDP-- 139
            |..:.|.|:|..| .:|.||.:||:..|.|..::..:...|||.:.|:.|       |:..||  
  Fly   118 CSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHL-------PLHGDPDN 175

Human   140 -------HTE------------------------------------------------------- 142
                   :||                                                       
  Fly   176 LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNC 240

Human   143 ----------------------FLGPQKKTEQVQRDIGFWCPRH----LKTSGGQGYKFLGIDQC 181
                                  |||.::..:|..:......|.|    |...     :..|:..|
  Fly   241 QNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQ-----RIAGVPNC 300

Human   182 APPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSL 246
            ..||...:|.:||.:||..:|...|..|.|:||.|..||:||..||:||||||::.|.||.:|::
  Fly   301 GIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAV 365

Human   247 MYFI-GFLLGDSTACNKADEKLELGDTVVLGSQN---KACTVLFMLLYFFTMAGTVWWVILTITW 307
            .|.. .||..:..||          |.::|...:   .:||::|:|.|||.||.::|||||:.||
  Fly   366 GYLSRNFLQNEEIAC----------DGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTW 420

Human   308 FLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVL 372
            |||||.||..|||.:.:.:||..||..|...:|.:|.::.|:||.|.|:|:||..:.|..:.|||
  Fly   421 FLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVL 485

Human   373 LPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGR-----NQEKLKKFMIRIGVFSGLYLVPLVTLL 432
            .||.:.:.:|.:.|:||.:||..:|.||:..|.     ..:||:|.|||||:||.||.||...::
  Fly   486 APLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVI 550

Human   433 GCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSK 497
            |||:|        |..:..|..:....||........:|..::.|:||.|.|.|||::..|:.|.
  Fly   551 GCYLY--------EAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSG 607

Human   498 KTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTST 562
            ||...|..|::|.......:.:.:.|       :|....:.|.   |..|         .||...
  Fly   608 KTLESWRRFWRRLLGAPDRTGANQAL-------IKQRPPIPHP---YAGS---------GMGMPV 653

Human   563 GATANH---------GTSAVAITSHDYLGQETLTEIQTSPETS-MREVKADGAST 607
            |:.|..         |.::||.|||.:|....|.:    |..| : ..::.||||
  Fly   654 GSAAGSLLATPYTQAGGASVASTSHHHLHHHVLKQ----PAASHVXHGESGGAST 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FZD6NP_001158087.1 CRD_FZ6 20..146 CDD:143559 51/213 (24%)
Frizzled 189..507 CDD:279827 129/327 (39%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. {ECO:0000250} 498..503 2/5 (40%)
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 46/126 (37%)
Frizzled 308..618 CDD:279827 129/328 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.