DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EOMES and byn

Sequence 1:NP_001265111.1 Gene:EOMES HGNCID:3372 Length:705 Species:Homo sapiens
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:562 Identity:179/563 (32%)
Similarity:246/563 (44%) Gaps:136/563 (24%)


Human   211 GAGAGSGAGGSSGGGGGPGTYQY-SQGAPLYGPYPGAAAAGSCGG-----------LGGLGVPGS 263
            |..:|.|.||.:|||.|.|:.|: :.....:|...|..||.|.||           :||.|.|..
  Fly    18 GNVSGGGGGGGAGGGAGSGSPQHVTHNGHGHGHGLGGVAAVSGGGASVSGNGGHRVVGGAGSPNE 82

Human   264 GFR-AHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHW 327
            ..| ..:.|.:|.|||:|.....|||:||.||||||.:..:.:||:|.|.|.|.:|.|..|.:.|
  Fly    83 LDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRW 147

Human   328 RFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQS 392
            ::..|:||..|||: ....|.:||||||||.|:|||::.|||.|:||||.   .|.|.| |:|.|
  Fly   148 KYVNGEWVPGGKAE-VPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK---TNGNGQ-IMLNS 207

Human   393 LHKYQPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDN 457
            ||||:||:|:|.|.       :|.....|:.|.||||||||||||.::|.|||.:|||||.|.|.
  Fly   208 LHKYEPRVHLVRVG-------SEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDA 265

Human   458 YD-------------------SMYTASENDRLTPSPTDSPRSHQIV---------------PGG- 487
            .:                   :.|||:......|.|....:||.:|               .|| 
  Fly   266 KERPDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGS 330

Human   488 --RYG----VQSFFPEPFVNTLPQARYYNGERTV--PQTNGLLSPQQSEEVANP--PQRWLVTPV 542
              |||    .:|..|   ..|.|    |:..|.|  ..:||......|.....|  ||    ||.
  Fly   331 CDRYGRSLSSRSVAP---TRTTP----YSRPRVVSGSGSNGSAGNASSTSPQPPSAPQ----TPT 384

Human   543 QQPGTNKLDISSYESEYTSSTLLPYGIKSLP----LQTSHA----LGYYPDPT---FPAMAGWGG 596
            ....|:...:|:..|..:..     ||.|.|    ..:|:|    :.....||   |...:.|..
  Fly   385 SLHSTSTGSVSTSVSSSSGG-----GIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQS 444

Human   597 RGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKR 661
            .|:|         |.:.:.|.....:..|...:..       ...||    .:|.|..||::   
  Fly   445 NGNY---------WNATSVPGPMPMNVCSGRNISS-------HNSPS----PTNGSPSYTTS--- 486

Human   662 RRLSPSNSSNENSPSIKCEDINAEEYSK------DTSKGMGG 697
               |||.:.:..:|       ::.:|:.      .|..|:||
  Fly   487 ---SPSYTIHHLTP-------HSHQYNMAQTDIYGTGVGVGG 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 95/212 (45%)
T-box_assoc 482..703 CDD:292794 54/260 (21%)
bynNP_524031.2 TBOX 86..268 CDD:238106 95/194 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.