DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HIST3H3 and cid

Sequence 1:NP_003484.1 Gene:HIST3H3 HGNCID:4778 Length:136 Species:Homo sapiens
Sequence 2:NP_523730.2 Gene:cid FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster

Alignment Length:144 Identity:49/145 (34%)
Similarity:68/145 (47%) Gaps:21/145 (14%)


Human     3 RTKQTARKSTGGKAPRKQLATKVA-------RKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
            |:.|| |:.|..:..:.:.|..||       ||:|......|:..         |||||.|....
  Fly    91 RSPQT-RRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQHHPG 145

Human    61 LLIRKLPFQRLMREIAQDFKTD--LRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPK 123
            .||.||||.||:||....:..|  ||....|::|:||:||.||.....|:.:...|..|||:..:
  Fly   146 TLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVR 210

Human   124 DIQLARRI--RGER 135
            |:.|...|  ||.:
  Fly   211 DMALMAYICDRGRQ 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HIST3H3NP_003484.1 PTZ00018 1..136 CDD:185400 49/145 (34%)
cidNP_523730.2 Histone 90..219 CDD:278551 47/138 (34%)
H4 135..219 CDD:304892 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.