DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARID1A and osa

Sequence 1:NP_006006.3 Gene:ARID1A HGNCID:11110 Length:2285 Species:Homo sapiens
Sequence 2:NP_001163639.1 Gene:osa FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster

Alignment Length:2822 Identity:777/2823 (28%)
Similarity:1068/2823 (38%) Gaps:881/2823 (31%)


Human    23 ELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGG 87
            ::|..:.||:::.|..|.||.....|....||    ..|..|||.|                   
  Fly     4 KIKSPQTQQQQQGGAPAPAATPPSAGAAPGAA----TPPTSGPPTP------------------- 45

Human    88 AGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQ 152
             .:....|::|.::....|..|.|                    .|||        |||..|.|.
  Fly    46 -NNNSNNGSDPSIQQQQQNVAPHP--------------------YGAP--------PPPGSGPGG 81

Human   153 PYGRSPSAVAAAAAAVFHQQHGGQQS----PGLAALQSGGG------GGLEPYAGPQQNSHDHGF 207
            |.|..|:||..     :|..|..||.    |.:...|..||      ||...:|...:..:.|..
  Fly    82 PPGPDPAAVMH-----YHHLHQQQQQHPPPPHMQQQQHHGGPAPPPPGGAPEHAPGVKEEYTHLP 141

Human   208 PNH---QYNSYY--PNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPP----------PSSSA 257
            |.|   .|..|:  ||...|            |.|.|      ..|.|||          |....
  Fly   142 PPHPHPAYGRYHADPNMDPY------------RYGQP------LPGGKPPQQQQPHPQQQPPQQP 188

Human   258 SASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQD 322
            ....|.:...|||:..           |.|....|||||.||.|.:.....|......|.  ||.
  Fly   189 GPGGSPNRPPQQRYIP-----------GQPPQGPTPTLNSLLQSSNPPPPPQHRYANTYD--PQQ 240

Human   323 GGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQM 387
                             |||:||||||   |||:....|..||..            |..|..| 
  Fly   241 -----------------AAASAAAAAA---AQQQQAGGPPPPGHG------------PPPPQHQ- 272

Human   388 GKMRPQPYGGTNPYSQQQG---PPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQ 449
                |.||||      |||   ||..|......|.|.|  :||   |.|...|.||         
  Fly   273 ----PSPYGG------QQGGWAPPPRPYSPQLGPSQQY--RTP---PPTNTSRGQS--------- 313

Human   450 QIPPYGQQGPSGYGQ-QGQTPYY-NQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQ 512
               ||    |..:|| .|..|.. .||....||||....|||....|...|....|   |||  |
  Fly   314 ---PY----PPAHGQNSGSYPSSPQQQQQQQQQQQQQAGQQPGGPVPGGPPPGTGQ---QPP--Q 366

Human   513 SSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPP------YSQPQAQSPYQQQQPQQPAP- 570
            .:.||.||.          :|||      |::|  .||      .:...|.|.:|..:|.:|.| 
  Fly   367 QNTPPTSQY----------SPYP------QRYP--TPPGLPAGGSNHRTAYSTHQYPEPNRPWPG 413

Human   571 -STLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQS 634
             |:.|..:.:|.|.:.........||. |||..:|  :.|...||:|....|...|..     |:
  Fly   414 GSSPSPGSGHPLPPASPHHVPPLQQQP-PPPPHVS--AGGPPPSSSPGHAPSPSPQPS-----QA 470

Human   635 RPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSP-HLPGIRGPSPS 698
            .||...:|.|.       .....|.|.:.||:.|......|| |....|..|| ...|.|..||:
  Fly   471 SPSPHQELIGQ-------NSNDSSSGGAHSGMGSGPPGTPNP-QQVMRPTPSPTGSSGSRSMSPA 527

Human   699 -----PVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQR--- 755
                 |:..|||...|..||:....|.....||.||        ||.|......|.:...|:   
  Fly   528 VAQNHPISRPASNQSSSGGPMQQPPVGAGGPPPMPP--------HPGMPGGPPQQQQSQQQQASN 584

Human   756 -------NPQMPQYSSPQPGSALS--------PRQPSGG------QIHTGMGSYQQNSMG----- 794
                   :||.....:|.|...::        |:..:||      .:|   |.|:....|     
  Fly   585 SASSASNSPQQTPPPAPPPNQGMNNMATPPPPPQGAAGGGYPMPPHMH---GGYKMGGPGQSPGA 646

Human   795 -SYGPQGGQYGPQGGYPRQPNYNALPNANYP-----SAGMAGGINPMGAGGQMHGQPG------- 846
             .|.||..|..|.|.||.:|.|.....|..|     |...|||.|.|.:|.|..|.||       
  Fly   647 QGYPPQQPQQYPPGNYPPRPQYPPGAYATGPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHT 711

Human   847 --IPPYGTLPP--------GRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAM 901
              .|||..:||        |....|.:||...|  ....||.|..|. |||.|.........:..
  Fly   712 GQYPPYQWVPPSPQQTVPGGAPGGAMVGNHVQG--KGTPPPPVVGGP-PPPQGSGSPRPLNYLKQ 773

Human   902 HVAANSIQNR------------PPGYPN----MNQGGMMG----TGPPYG--------------- 931
            |     :|::            |.||.|    |:.|..||    .|||:|               
  Fly   774 H-----LQHKGGYGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQ 833

Human   932 -------QGINSMAGM-------------INPQGPPYSMG-----------------------GT 953
                   ||..:..|.             |:..||..:.|                       .|
  Fly   834 MLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQST 898

Human   954 MANNSAGMAASPEMMGLGDVKLTPATKMNN----------------------------------- 983
            ::|.||.....|:.       .||.::.|:                                   
  Fly   899 LSNASAASGEDPQC-------TTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPP 956

Human   984 ---KADGTPKT-------ESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGM 1038
               :..|:|:.       :...:.:.::|..::.:.||||:...|:|:.|:|:..||.||:...:
  Fly   957 NWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPI 1021

Human  1039 TNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF 1103
            |..|.:.::||||||||:.|||.||..:|.|:|.|:::|..|.:|.|||||.:|:|.|.:.|..|
  Fly  1022 TACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTF 1086

Human  1104 ECKIERGE-DPPPDI--FAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTP 1165
            ||..:||: ||.|.|  ..|...||:......|||.|.....|  |..||.||.::  |..|..|
  Fly  1087 ECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAG--TTNSTGSSNSQ--DSFPAPP 1147

Human  1166 ASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ------KRNSMTPNPGYQPSMNTSDMMGRM 1224
            .|.|::.|...||....:...:.........:..|      :.|..||:||...::...|.:...
  Fly  1148 GSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGDNISVS 1212

Human  1225 SYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPG-LGNVAMGPRQHYP-------- 1280
            :  |.:||.     |.|..|...:|.||..|.| |.:.:.|.| :|.|..||:.|.|        
  Fly  1213 N--PFEDPI-----AAGGGPGSGTGPGPGQGPG-PGAASGGAGAVGAVGGGPQPHPPPPHSPHTA 1269

Human  1281 ---YGGPYDRVRTE---PGI----------GPEGNM---STG-----APQ---PNLMPSNPD--- 1315
               ..|.:.:...:   ||:          |.:|..   |.|     |||   |..:|.:|.   
  Fly  1270 AQQAAGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQHV 1334

Human  1316 ------------SGMYSP-SRYPPQQQQQQQQRHDSYG--NQFSTQGTPSGSPF-------PSQQ 1358
                        ||..:| ||.|......|...:..||  :|::..| |.|.||       |.|.
  Fly  1335 RPAAGAPYPPGGSGYPTPVSRTPGSPYPSQPGAYGQYGSSDQYNATG-PPGQPFGQGPGQYPPQN 1398

Human  1359 TTMYQQQ------------------QQNYKRPMDG---------TYGPPAKRHEGEMYSVPYSTG 1396
            ..||...                  .:.|.:|..|         ..||||....|...|..|.| 
  Fly  1399 RNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPPPGGPQPPTQTVAGGPPAGGAPGAPPSSAYPT- 1462

Human  1397 QGQPQQQ---QLPPAQ-PQPASQQ---QAAQPSP----QQDVY-------NQYGNAYPATAT--- 1440
             |:|.||   |.||.| |||....   :.:||.|    :..:|       .||...||::..   
  Fly  1463 -GRPSQQDYYQPPPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSGTQQYRPQYPSSPAPQN 1526

Human  1441 --------AATE---------RRPAG-------------GP-------------QNQFPFQFGRD 1462
                    ||..         ::|||             ||             |.|.|:|    
  Fly  1527 WGGAPPRGAAPPPGAPHGPPIQQPAGVAQWDQHRYPPQQGPPPPPQQQQQPQQQQQQPPYQ---- 1587

Human  1463 RVSAPPGTNAQQNMPPQMM---------------GGPIQASAEVAQQGTMWQGRNDMTYNYANRQ 1512
            :|:.|||....| .|||..               |.|::..:...||..|    ..|.......|
  Fly  1588 QVAGPPGQQPPQ-APPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQNRM----PGMPAQQQQSQ 1647

Human  1513 STGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPV-PPMTRPPPSN----- 1571
            ..|..||.|              .|:|:| |..||.|.  |..||...| ||...|||.:     
  Fly  1648 QQGGVPQPP--------------PQQASH-GGVPSPGL--PQVGPGGMVKPPYAMPPPPSQGVGQ 1695

Human  1572 ---YQPPPSMQNHIPQVSSPAPLP------RPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAP 1627
               ..||..|.:     ..|.|:|      :|::.:....:.|..|...:.|.. ..:|.:..||
  Fly  1696 QVGQGPPGGMMS-----QKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHP-HQMPPNQTAP 1754

Human  1628 APVQPP--------MIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAES 1684
            ....||        ::::::.||..|||:|.|||.:|:||...|:...:.||:.|:::||||.|.
  Fly  1755 GGYGPPGMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLTEC 1819

Human  1685 TWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGR 1749
            |||||.:|:||:||:::..|.:|.|||||.||:|:|::.|.|:|   .|.|              
  Fly  1820 TWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLAEMF---DERE-------------- 1867

Human  1750 FSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVV------------------------ENDEEIAF 1790
                        .||:..||....:::.:...|                        .:.|.:..
  Fly  1868 ------------NEEQSALLAEDADDDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDR 1920

Human  1791 SGKD--------KPASE-----------NSEEK-LISKFDK---------LPVKI-VQKNDPFVV 1825
            ||||        :.|.|           |.||: |:..|..         :||:| ..:||.|| 
  Fly  1921 SGKDGAGNGSDSEDADEGIDLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVRIQPAENDIFV- 1984

Human  1826 DCSDKLGRVQEFDSGLLH----------WRIG--------------------------------G 1848
               |:..:..:.|:..|:          |..|                                |
  Fly  1985 ---DERQKAWDIDTNRLYEQLEPVGSDAWTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKG 2046

Human  1849 GDTTE--------HIQT--------------------------HFESKTELLPSRPHAPCPPAPR 1879
            ...||        .|:|                          |.|.|...|.|...|    .|.
  Fly  2047 RKRTELASSSRKPEIKTEENSTEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLTSEEFA----QPN 2107

Human  1880 KHVTTAEGTPGTTDQEGPPPD---GPPEKRITATMDDMLSTRS----STLTEDGAKSSEAIKESS 1937
            ..|   :..|||.|.:..|.|   ..|::|:|..:....||.:    .|..:|.|:..:..::||
  Fly  2108 AEV---KKEPGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRDSS 2169

Human  1938 KFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMS 2002
                             .|||.:::||..|..:.:.|||||:||:.:||..|:|:|||||:..::
  Fly  2170 -----------------FEDECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLA 2217

Human  2003 KHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKV----EWWWDCLEMLRENTLVT 2063
            |....|.:||:|:||:|:|..|......|::||:.|...||:.:    |||||.|..:|||.||.
  Fly  2218 KSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVA 2282

Human  2064 LANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQ 2128
            :|||:|.|:||.|.|.|..|::||||||||||||..||||.:.|||:|||||||.||.|.||.:.
  Fly  2283 MANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVT 2347

Human  2129 DNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIG 2193
            |.||||::|||||||||||.:.:.|.|...::.|.||.:|.||..||..||..||.:|:|...|.
  Fly  2348 DANVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCIS 2412

Human  2194 NLLGFLEDSLAATQFQQSQASLLHM-QNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESR 2257
            .|:.|:|.:........:|..:.:: :||....||:||:||||..||.|||..:|.|.|...|.|
  Fly  2413 YLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQR 2477

Human  2258 LLDISVSPLMNSLVSQVICDVLFLIGQ 2284
            ||.:.:|.:::..|:.:|..||:.:.:
  Fly  2478 LLGLVMSHILDQQVALIISRVLYQVSR 2504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARID1ANP_006006.3 LXXLL 295..299 3/4 (75%)
DUF3498 596..>881 CDD:288827 94/343 (27%)
BRIGHT 1018..1109 CDD:128777 42/91 (46%)
Nuclear localization signal. {ECO:0000269|PubMed:26614907} 1368..1387 8/28 (29%)
LXXLL 1709..1713 4/4 (100%)
LXXLL 1967..1971 1/4 (25%)
DUF3518 1976..2231 CDD:288854 126/260 (48%)
LXXLL 2085..2089 3/4 (75%)
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 42/91 (46%)
DUF3518 2191..2451 CDD:288854 126/260 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112441461
eggNOG 1 0.900 E1_KOG2510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 634 1.000 Inparanoid score I818
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D135670at33208
OrthoFinder 1 1.000 FOG0001960
OrthoInspector 1 1.000 T609318
orthoMCL 1 0.900 OOG5_131090
Panther 1 1.100 O PTHR12656
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4068
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.