DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT3G27870 and CG33298

Sequence 1:NP_189425.2 Gene:AT3G27870 AraportID:AT3G27870 Length:1189 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1363 Identity:431/1364 (32%)
Similarity:641/1364 (47%) Gaps:300/1364 (22%)


plant    28 HSQIGSRG--------------YSRVVFCNDPDNPEALQLNYR---------------------- 56
            ||:..||.              :.|:..||.....:..:.:||                      
  Fly   186 HSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQF 250

plant    57 -GNYVSTTKYTAANFIPKSLFEQFRRVANIYFLVVAFVSFSP-LAPYTAPSVLAPLLIVIGATMV 119
             ||.:.|||||..:||||:|.|||.||||:||:.:..:::.| ::.:.....:.|:|.|:|.|.|
  Fly   251 VGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAV 315

plant   120 KEGVEDLRRRKQDVEANNRKVEVL-GKTGTFVETKWKNLRVGDLVKVHKDEYFPADLLLLSSSYE 183
            |:..||.|||..|...||....|. |:|..:.:.||:.|||||:|.:..:|..|||:|||.:|..
  Fly   316 KDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDP 380

plant   184 DGICYVETMNLDGETNLKLKHALEITSDEESI---KNFRGMIKCEDPNEHLYSFVGTL-YFEGKQ 244
            .|:||::|.:||||||||.:..:....:.:||   ..|...::.:.|...||.|.|.| :..|::
  Fly   381 QGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGER 445

plant   245 YPLSPQQILLRDSKLKNTDYVYGVVVFTGHDTKVMQNATDPPSKRSKIEKKMDQIIYILFSILIV 309
            .|:|.:.:|||:|:||||||:.|:||:.||:||.|.|.:.|..|||::|::|:..:.....||::
  Fly   446 VPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLI 510

plant   310 IAFTGSVFFGIATRRDMSDNGKLRRWYLRPDHTTVFYDPRRAVAA---AFFHFLTALMLYGYLIP 371
            :...|::              ..|.|.....|..|.|.|...:.|   :.:.|.|.:::...:||
  Fly   511 LCVVGAI--------------GCRMWLSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIP 561

plant   372 ISLYVSIEVVKVLQSIFINQDQEMYHEETDRPARARTSNLNEELGQVDTILSDKTGTLTCNSMEF 436
            :||||:||:.|:||...|:.:.:::..||::....|..|:.|||||:..|.:|||||||.|.|.|
  Fly   562 LSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIF 626

plant   437 VKCSIAGTAYGRGMTEVEVALRKQKGLMTQEEVGDNESLSIKEQKAVKGFNFWDERIVDGQWINQ 501
            .:|.:.|:.|....:|:|....|...........||.:..:.:             :..|.::. 
  Fly   627 RRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQ-------------LTQGTYLT- 677

plant   502 PNAELIQKFFRVLAICHTAI--------------------------------------------- 521
            |:|:.||:|..|||||:|.|                                             
  Fly   678 PHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTT 742

plant   522 ------------PDV-------------------------------------------------- 524
                        |.|                                                  
  Fly   743 TTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPN 807

plant   525 ----------------------------------------------------NSDTGEI------ 531
                                                                :|.||.|      
  Fly   808 SESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADG 872

plant   532 --TYEAESPDEAAFVIASRELGFEFFSRSQTSISLHEIDHMTGEKVDRVYELLHVLEFSSSRKRM 594
              .||||||||.|.|.|:........:||...|    :..|......|.||:|.||.|.||||.|
  Fly   873 RPLYEAESPDELALVNAAYSYDCCLLNRSPNQI----LVSMPMAGATREYEILKVLPFDSSRKCM 933

plant   595 SVIVRN-PENRLLLLSKGADSVMFKRLAKHGRQN-----ERETKEHIKKYAEAGLRTLVITYREI 653
            |::||. ....::|.:|||||.:...|......:     ..:|::.:.:||..|||.||:..|.:
  Fly   934 SIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTL 998

plant   654 DEDEYIVW---EEEFLNAKTLVTEDRDALIDAAADKIEKDLILLGSTAVEDKLQKGVPDCIEKLS 715
            :..:|..|   .:|.    .:..|:|:..:..:..|:|.:|.|||:|.:||:||.|||:.|..|.
  Fly   999 NSADYTDWWARHQEI----EMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLL 1059

plant   716 QAGVKIWVLTGDKTETAINIGYACSLLREGMKQILVTLDSSD-------IEALEKQGDKEAVAKA 773
            .||:.:|||||||.||||||.|:..|..:.|:.|.:|..|.|       ....:.:.||......
  Fly  1060 SAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDKTTSTLG 1124

plant   774 SFQSIKKQLREGMSQTAAVTDNSAKENSEMFGLVIDGKSLTYALD--SKLEKEFLELAIRCNSVI 836
            ..||::|:.|                     .||:|||:||:.||  |||...||.|:.||.||:
  Fly  1125 YGQSLRKKQR---------------------ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVL 1168

plant   837 CCRSSPKQKALVTRLVKNGTGRTTLAIGDGANDVGMLQEADIGVGISGAEGMQAVMASDFAIAQF 901
            ||||:|.|||.:.::||......|||||||||||.|:|.||:||||||.||||||||:||.:.:|
  Fly  1169 CCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRF 1233

plant   902 RFLERLLLVHGHWCYRRITLMICYFFYKNLAFGFTLFWYEAYASFSGKPAYNDWYMSCYNVFFTS 966
            |:||||||.||:|||.|::.||.||||||.||.|.:|||:.|..|||:...:..|:..||:.|||
  Fly  1234 RYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTS 1298

plant   967 LPVIALGVFDQDVSARLCLKYPLLYQEGVQNVLFSWERILGWMLNGVISSMIIFFLTINTMATQA 1031
            ||.:|:||:|:.|:..|.||.|.||:.|...|.:........:|:.:..|::|||:.:...|   
  Fly  1299 LPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYA--- 1360

plant  1032 FRKDGQVVDYSVLGVTMYSSVVWT--VNCQMAISINYFTWIQHCFIWGSIGVWYLFLVIYGSL-P 1093
             ..|..:.::   |.|:.:|.::.  |:|  ||.|..:|.:....|..|:|.:|||.::|.|: .
  Fly  1361 -ESDVGIWEF---GTTITASCLFANLVHC--AIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCM 1419

plant  1094 PTFSTTAFQVFVETSAPSPIYWLVLFLVVFSALLPYFTYRAFQIKFRPMYHDIIVEQRRTERT 1156
            ..|...:....:.....|.::|||:.|....|:||.......:|...|.....::.|.:.||:
  Fly  1420 NCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRERS 1482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT3G27870NP_189425.2 PhoLip_ATPase_N 39..102 CDD:292826 26/87 (30%)
ATPase-Plipid 55..1149 CDD:273734 421/1314 (32%)
Cation_ATPase 517..619 CDD:289987 45/270 (17%)
HAD_like <758..891 CDD:304363 61/135 (45%)
PhoLip_ATPase_C 891..1142 CDD:292829 93/254 (37%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 22/50 (44%)
ATPase-Plipid 250..1473 CDD:273734 419/1289 (33%)
E1-E2_ATPase 302..>394 CDD:278548 41/92 (45%)
Cation_ATPase <880..965 CDD:289987 33/89 (37%)
HAD_like <1177..1240 CDD:304363 41/63 (65%)
PhoLip_ATPase_C 1223..1468 CDD:292829 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.