DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT3G25610 and CG33298

Sequence 1:NP_189189.1 Gene:AT3G25610 AraportID:AT3G25610 Length:1202 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1345 Identity:415/1346 (31%)
Similarity:637/1346 (47%) Gaps:322/1346 (24%)


plant    36 PGFSRVVYCN---------------------EPGSPAAERRN--YAGNYVRSTKYTVASFFPKSL 77
            |.:.|:..||                     .|.:|..:..|  :.||.:|:||||:.||.||:|
  Fly   206 PWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNL 270

plant    78 FEQFRRVANFYFLVTGILS-LTDLSPYGAVSALLPLALVISATMVKEGIEDWRRKQQDIEVNNRK 141
            .|||.||||.||:...:|: :.::|.:|...|::|:..|:..|.||:..||.||:..|..:||..
  Fly   271 LEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTT 335

plant   142 VKVHDG-NGIFRQEEWRNLRVGDIVRVEKDEFFPADLLLLSSSYEDSVCYVETMNLDGETNLK-- 203
            .:|:|| ...:::.:|:.|||||||.:..:|..|||:|||.:|....|||::|.:||||||||  
  Fly   336 CRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR 400

plant   204 -VKQGLEATSSLLNQDSDFKDFRGVVRCEDPNVNLYVFVGTLALEE-ERFPLSIQQILLRDSKLR 266
             |.:|.|...|:.....    |...|..:.|...||.|.|.|.... ||.|:|.:.:|||:|:|:
  Fly   401 EVVRGFEEMQSIFVPSK----FVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLK 461

plant   267 NTEYVYGAVVFTGHDTKVIQNSTDPPSKRSRIERTMDKIIYLMFGLVFLMSFVGSIIFGVETRED 331
            ||:|:.|.||:.||:||.:.|::.|..|||::|:.|:..:.....::.::..||:|         
  Fly   462 NTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAI--------- 517

plant   332 KVKNGRTERW----------YLKPDDADIFFDPERAPMAAIYHFFTATMLYSYFIPISLYVSIEI 386
                 ....|          ||.|:..       .|.|.:::.|:|..::....||:||||:||:
  Fly   518 -----GCRMWLSSFTHFPVPYLPPNKL-------TANMESMWIFWTYIVILQVMIPLSLYVTIEL 570

plant   387 VKVLQSIFINRDIHMYYEETDKPAQARTSNLNEELGMVDTILSDKTGTLTCNSMEFIKCSIAGKA 451
            .|:||...|:.::.::..||:|..:.|..|:.||||.:..|.:|||||||.|.|.|.:|.:.|..
  Fly   571 CKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSD 635

plant   452 YGRGITEVERAMAVRSGGSP--LVNEDLDVVVDQSGPKVKGFNFEDERVMNGNWVRQPEAAVLQK 514
            |....:|:|:..:.....:|  :.|::|              |.:..::..|.:: .|.|..:|:
  Fly   636 YNHPPSELEKIYSKPGAPAPPLIPNDNL--------------NSDMAQLTQGTYL-TPHAQRIQE 685

plant   515 FFRLLAVCHTAI----------------------------------------------------- 526
            |..:||:|:|.|                                                     
  Fly   686 FLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIING 750

plant   527 -------------------------------------------------------PETDEES--- 533
                                                                   |.::.||   
  Fly   751 PTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSP 815

plant   534 --------------------------------------------------------GNVSYEAES 542
                                                                    |...|||||
  Fly   816 PMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAES 880

plant   543 PDEAAFVVAAREFGFEFFNRTQNGISFRELDLVSGEK--VERVYRLLNVLEFNSTRKRMSVIVRD 605
            |||.|.|.||..:.....||:.|.|      |||...  ..|.|.:|.||.|:|:||.||::||.
  Fly   881 PDELALVNAAYSYDCCLLNRSPNQI------LVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQ 939

plant   606 -DDGKLLLLSKGADNVMFERL---AKNGRQ--FEAKTQEHVNQYADAGLRTLVLAYREVDENEYI 664
             ...:::|.:||||:.:...|   :.|..:  ...:||:.:::||..|||.||:|.|.::..:|.
  Fly   940 IGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYT 1004

plant   665 EFNKSFNEAKASVSEDREALIDEITDKMERDLILLGATAVEDKLQNGVPECIDKLAQAGIKIWVL 729
            ::.....|.:.|: |:||..:.:...|:|.:|.|||||.:||:||:||||.|..|..|||.:|||
  Fly  1005 DWWARHQEIEMSL-ENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVL 1068

plant   730 TGDKMETAINIGFASSLLRQEMKQIIINLETPQIKSLEKSGGKDEIELA--------SRESVVMQ 786
            ||||.||||||.:::.|..|:|:.|.:...:           :|..|.|        ..:.....
  Fly  1069 TGDKPETAINIAYSAKLFTQQMELIRLTARS-----------RDAAETAINFYLTDMENDKTTST 1122

plant   787 LQEGKALLAASGASSEAFALIIDGKSLTYALEDEIKKM--FLDLATSCASVICCRSSPKQKALVT 849
            |..|::|      ..:..||::|||:||:.|:.:.|.:  ||.|:..||||:||||:|.|||.:.
  Fly  1123 LGYGQSL------RKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLV 1181

plant   850 RLVKSGTGKTTLAIGDGANDVGMLQEADIGVGISGVEGMQAVMSSDIAIAQFRYLERLLLVHGHW 914
            ::||......|||||||||||.|:|.||:||||||.|||||||::|..:.:|||||||||.||:|
  Fly  1182 KVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYW 1246

plant   915 CYSRIASMICYFFYKNITFGVTVFLYEAYTSFSGQPAYNDWFLSLFNVFFSSLPVIALGVFDQDV 979
            ||.|::.||.||||||..|...:|.|:.|..||||...:..:|.|:|:.|:|||.:|:||:|:.|
  Fly  1247 CYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRV 1311

plant   980 SARFCYKFPLLYQEGVQNILFS----WKRIIGWMFNGFISALAIFF--LCKESLKHQLFDPDGKT 1038
            :.....|.|.||:.|...:.:.    |..::..::    .:|.|||  ||..:      :.|   
  Fly  1312 AEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALY----QSLVIFFVALCAYA------ESD--- 1363

plant  1039 AGREILG----GTMYTCVVWVVNL-QMALSISYFTWVQHIVIWGSIAFWYIFLMIYGAMTPS-FS 1097
                 :|    ||..|......|| ..|:.|..:|.:..:.|..|:..:|:|.::|.::..: |.
  Fly  1364 -----VGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFG 1423

plant  1098 T-DAYMVFLEALAPAPSYWLTTLFVMIFALIPYFVYKSVQMRFFP 1141
            . .:|.|.....|.| .:||..:...:.|::|..:..:|::...|
  Fly  1424 VRSSYWVIFVCFASA-VHWLVIMLSTVVAVLPRLLLTTVRISLCP 1467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT3G25610NP_189189.1 PhoLip_ATPase_N 41..107 CDD:292826 29/90 (32%)
ATPase-Plipid 57..1148 CDD:273734 408/1302 (31%)
Cation_ATPase 521..624 CDD:289987 44/273 (16%)
COG4087 <840..898 CDD:226572 36/58 (62%)
PhoLip_ATPase_C 891..1141 CDD:292829 83/263 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 408/1302 (31%)
E1-E2_ATPase 302..>394 CDD:278548 39/92 (42%)
Cation_ATPase <880..965 CDD:289987 34/91 (37%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 84/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.