DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LZTR1 and Lztr1

Sequence 1:NP_006758.2 Gene:LZTR1 HGNCID:6742 Length:840 Species:Homo sapiens
Sequence 2:NP_001259114.1 Gene:Lztr1 FlyBaseID:FBgn0040344 Length:998 Species:Drosophila melanogaster

Alignment Length:839 Identity:428/840 (51%)
Similarity:560/840 (67%) Gaps:75/840 (9%)


Human     2 AGPGSTGGQIG--AAALA-----GGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETVHRWRRLPP 59
            :|||.:|..:.  ||:.|     .|:....:|.   .:||:    .|.::|..:...|:|.|:..
  Fly   186 SGPGGSGCSMAYDAASNASSGSGSGSGKATSPG---SYSCN----ALNVDFTSYTATHQWTRMLE 243

Human    60 CDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTPPAPRYHHSAV 124
            |.|||||:||||||||||||::||||||||.|||||:||.|||.||.||..||||||||||||||
  Fly   244 CAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPAPRYHHSAV 308

Human   125 VYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLPVARSAHGATVYSDKLWI 189
            |.|||||:||||||||:|||||.||||||||||.:..|.|||..||.||.||||||.||.:|:||
  Fly   309 VAGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRSAHGAAVYDNKMWI 373

Human   190 FAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVFSGQSGAKITNN 254
            :||||||||||||||:.|.....  ||||.|.|:.||:||||||||.||.|:|||||||.:|||:
  Fly   374 YAGYDGNARLNDMWTLNLTGENQ--WEEVDQLGDRPPTCCNFPVAVARDAMYVFSGQSGLQITNS 436

Human   255 LFQFEFKDKTWTRIPTEHLLRG-SPPPPQRRYGHTMVAFDRHLYVFGGAADNTLPNELHCYDVDF 318
            ||:|.||.:||.||..|.:||| :..||.||||||||..||.||||||:||:||||:|||||:|.
  Fly   437 LFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLYVFGGSADSTLPNDLHCYDLDS 501

Human   319 QTWEVVQPSSDSEVGGAEVPERACASEEVPTLTYEERVGFKKSRDVFGLDFGTTSAKQPTQPASE 383
            |.|.|:||..:|:|                                                   
  Fly   502 QVWSVIQPEQNSDV--------------------------------------------------- 515

Human   384 LPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFV 448
             ||||:|||:|||.||||||||||||::|.|:.||||||.||||||.:|:|:.::.:||||::|:
  Fly   516 -PSGRVFHASAVICDAMYIFGGTVDNSVRRGDTYRFQFSSYPKCTLRDDFGKFFQDKQFCDIQFI 579

Human   449 LGEKEECVQGHVAIVTARSRWLRRKITQARERLAQKLEQ--EAAPVPREAPGVAAGGARPPLLHV 511
            :|.:|..:..|:|.|.|||::||.||..|||...|::|:  ....|...|....|||.|.|:|.|
  Fly   580 VGAEEIRILAHIAFVAARSKYLRNKILAAREARQQQMEKVYGVGQVDALALNAGAGGDRGPMLEV 644

Human   512 AIREAEARPFEVLMQFLYTDKIKYPRKGHVEDVLLIMDVYKLALSFQLCRLEQLCRQYIEASVDL 576
            .:..|....||:::.::|||:|..........::||.|:|:||..|.:.||...|.||::..::.
  Fly   645 RLANASPEAFEIILNYIYTDRIDLKDTYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINK 709

Human   577 QNVLVVCESAARLQLSQLKEHCLNFVVKESHFNQVIMMKEFERLSSPLIVEIVRRKQQPPPRTPL 641
            .|||....:|.:..:..:|:||:.|::||.:|..|:|..||..|..||:|||: ||:..|.:..:
  Fly   710 LNVLEALYNADKSNIKIIKDHCMQFIIKEENFTDVVMSSEFSDLDKPLLVEII-RKRLYPSKLVI 773

Human   642 DQPVD--IGTSLIQDMKAYLEGAGAEFCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDG 704
            |...:  |||:|..|:.|:||..|.:||||:|:|:.|..||||::|::|.:||:.|||||||.|.
  Fly   774 DTSYEGNIGTTLEIDLCAFLESTGKDFCDISLVLEDHVIPAHKSVLSSRCTYFQGMFRSFMPPDN 838

Human   705 QVNISIGEMVPSRQAFESMLRYIYYGEVNMPPEDSLYLFAAPYYYGFYNNRLQAYCKQNLEMNVT 769
            .|||.|||:.||.:||.|:||||||||..|||:|:||||.||.:||..||||.|:||.:||.|:|
  Fly   839 TVNIQIGEISPSLEAFHSLLRYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEHNIT 903

Human   770 VQNVLQILEAADKTQALDMKRHCLHIIVHQFTKVSKLPTLRSLSQQLLLDIIDSLA-SH 827
            .:||||.|||:|.|:..|:|.:.|.:||..|.||::||.:..||::|||:||.::| ||
  Fly   904 FENVLQTLEASDITKIYDIKEYALKLIVKDFAKVARLPKIAGLSRELLLEIIRAVADSH 962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LZTR1NP_006758.2 PLN02193 <44..223 CDD:330882 127/179 (71%)
KELCH repeat 68..114 CDD:276965 37/46 (80%)
Kelch 1. {ECO:0000255} 79..128 39/49 (80%)
KELCH repeat 118..172 CDD:276965 42/54 (78%)
Kelch 2. {ECO:0000255} 130..185 41/55 (75%)
PLN02193 160..>407 CDD:330882 132/248 (53%)
Kelch 3. {ECO:0000255} 187..238 34/51 (67%)
Kelch 4. {ECO:0000255} 239..285 28/47 (60%)
KELCH repeat 284..326 CDD:276965 31/42 (74%)
Kelch 5. {ECO:0000255} 295..341 25/46 (54%)
Kelch 6. {ECO:0000255} 399..450 32/51 (63%)
BTB 433..573 CDD:321966 51/142 (36%)
SPOP_C_like 574..634 CDD:269810 23/60 (38%)
BTB 665..753 CDD:306997 54/88 (61%)
SPOP_C_like 768..>807 CDD:269810 19/39 (49%)
Lztr1NP_001259114.1 PLN02153 237..554 CDD:177814 228/371 (61%)
KELCH repeat 252..298 CDD:276965 37/46 (80%)
Kelch_3 261..310 CDD:290151 40/49 (82%)
Kelch_5 299..>329 CDD:290565 27/30 (90%)
KELCH repeat 302..355 CDD:276965 42/53 (79%)
Kelch_1 358..400 CDD:279660 29/44 (66%)
KELCH repeat 359..407 CDD:276965 32/50 (64%)
KELCH repeat 410..455 CDD:276965 31/45 (69%)
Kelch_1 410..452 CDD:279660 30/42 (71%)
Kelch_1 466..509 CDD:279660 32/43 (74%)
KELCH repeat 467..509 CDD:276965 31/42 (74%)
BTB 564..704 CDD:279045 51/140 (36%)
BTB 575..707 CDD:197585 47/132 (36%)
SPOP_C_like 707..766 CDD:269810 23/60 (38%)
BTB 798..898 CDD:279045 61/100 (61%)
BTB 802..902 CDD:197585 62/100 (62%)
SPOP_C_like 902..960 CDD:269810 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296311153
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H4925
Inparanoid 1 1.050 837 1.000 Inparanoid score I445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1263405at2759
OrthoFinder 1 1.000 FOG0007486
OrthoInspector 1 1.000 T1072430
orthoMCL 1 0.900 OOG5_127972
Panther 1 1.100 LDO PTHR46376
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1494
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.