DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT3G13900 and CG33298

Sequence 1:NP_188006.4 Gene:AT3G13900 AraportID:AT3G13900 Length:1243 Species:Arabidopsis thaliana
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1379 Identity:435/1380 (32%)
Similarity:680/1380 (49%) Gaps:256/1380 (19%)


plant     2 GRRRIRSRIRKSHFYTFKCLRPKTLEDQGPHIINGPGYTRIVHCN-------QPHLHLAKVLRYT 59
            ||...|...|....||.:       ..:.|     |.:.|:..||       :...:...|..:|
  Fly   183 GRGHSRQASRSESIYTLR-------RTEAP-----PWWKRLTLCNYNTGDKFEERSYRTVVPNHT 235

plant    60 ----------------SNYVSTTRYNLITFLPKCLYEQFHRVANFYFLVAAILSVFP-LSPFNKW 107
                            .|.:.||:|.|::|:||.|.||||||||.||:...:|:..| :|.|.|.
  Fly   236 VPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKE 300

plant   108 SMIAPLIFVVGLSMGKEALEDWRRFMQDVKVNSRKATVHRGDGD-FGRRKWKKLRVGDVVKVEKD 171
            ..:.|::||:|::..|:..||.||...|.::|:....|:.|:.: :.:.||::|||||:|.:..:
  Fly   301 VAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNN 365

plant   172 QFFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRCLDVTLPLERDDTF---QSFSGTIKCEDP 233
            :..|||:|||.:|...|:||::|.:||||||||.:   :|....|...:.   ..|...::.:.|
  Fly   366 ETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR---EVVRGFEEMQSIFVPSKFVSRVEADAP 427

plant   234 NPNLYTFVGNLEY-DGQVYPLDPSQILLRDSKLRNTSYVYGVVVFTGHDTKVMQNSTKSPSKRSR 297
            ...||.|.|.|.: .|:..|:....:|||:|:|:||.|:.|:||:.||:||.|.|::....|||:
  Fly   428 TTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQ 492

plant   298 IEKRMDYIIYTLFALLVLVSFISSLGFAVMTKMHMGDWW-----YLRPDKPERLTNPRNPFHAWV 357
            :|::|:..:.....:|:::..:.::|    .:|.:..:.     ||.|:|   ||  .|....|:
  Fly   493 VEQQMNIDVIWCVIILLILCVVGAIG----CRMWLSSFTHFPVPYLPPNK---LT--ANMESMWI 548

plant   358 VHLITAVLLYGYLIPISLYVSIELVKVLQATFINQDLQMYDSESGTPAQARTSNLNEELGQVDTI 422
              ..|.:::...:||:||||:|||.|:||...|:.::.::|:|:....:.|..|:.|||||:..|
  Fly   549 --FWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHI 611

plant   423 LSDKTGTLTCNQMDFLKCSIAGTSYGVRASEVELAAAKQMA----------IDLDEEQGEEVTHL 477
            .:|||||||.|:|.|.:|.:.|:.|....||:|...:|..|          ::.|..|..:.|:|
  Fly   612 FTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYL 676

plant   478 PRTRGRMHGY------------AKMPSK----TSSDIELETV---------------ITATDEGD 511
            .....|:..:            ...|.:    .|..||::.:               :.|:....
  Fly   677 TPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTST 741

plant   512 QTQSTGIKGFSFEDQ----------RL-----------------------------MGGNWLNEP 537
            .|.:|.|.|.:.:.|          ||                             :..:..:.|
  Fly   742 TTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSP 806

plant   538 NSD---------------DILMFLRILAVCHTAI------------------PEVDEDT------ 563
            ||:               .|....|..||.::.|                  |.....|      
  Fly   807 NSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTAD 871

plant   564 GKCTYEAESPDEVAFLVAAGEFGFEFTKRTQSSVFISERHSGQPVEREYKVLNVLDFTSKRKRMS 628
            |:..||||||||:|.:.||..:......|:.:.:.:|...:|  ..|||::|.||.|.|.||.||
  Fly   872 GRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAG--ATREYEILKVLPFDSSRKCMS 934

plant   629 VIVRDEKGQ-ILLLCKGADSIIFERL---SKNGKNYL--EATSKHLNGYGEAGLRTLALSYRKLD 687
            ::||....| |:|..|||||.|...|   |.|....:  |.|.:.|:.|...|||.|.::.|.|:
  Fly   935 IVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLN 999

plant   688 ETEYSIWNSEFHKAKTSVGADRDEMLEKVSDMMEKELILVGATAVEDKLQKGVPQCIDKLAQAGL 752
            ..:|:.|.:...:.:.|: .:|:..|......:|..|.|:|||.:||:||.|||:.|..|..||:
  Fly  1000 SADYTDWWARHQEIEMSL-ENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGI 1063

plant   753 KIWVLTGDKMETAINIGYACSLLRQGMKQIYIALRNEEGSSQDPEAAARENILMQIIN------- 810
            .:|||||||.||||||.|:..|..|.|:.|.:..|     |:|....|....|..:.|       
  Fly  1064 SVWVLTGDKPETAINIAYSAKLFTQQMELIRLTAR-----SRDAAETAINFYLTDMENDKTTSTL 1123

plant   811 --ASQMIKLEKDPHAAFALIIDGKTLTYALEDDIK--YQFLALAVDCASVICCRVSPKQKALVTR 871
              ...:.|.::      ||::||||||:.|:...|  ..||.|:..||||:|||.:|.|||.:.:
  Fly  1124 GYGQSLRKKQR------ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVK 1182

plant   872 LAKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSIAQFRFLERLLVVHGHWC 936
            :.||.....|||||||||||.|||.||:||||||.||||||||:||::.:||:|||||:.||:||
  Fly  1183 VVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWC 1247

plant   937 YKRIAQMICYFFYKNITFGLTLFYFEAFTGFSGQAIYNDSYLLLFNVILTSLPVIALGVFEQDVS 1001
            |.|:::||.||||||..|...:|:::.:.|||||.:.:..||:|:|:|.||||.:|:||:::.|:
  Fly  1248 YDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVA 1312

plant  1002 SEVCLQFPALYQQGPKNLFF---DWYRIIGWMANGVYASVVIFSL--------NIGIFHVQSFCS 1055
            .::.|:.|.||:.|...:.:   |::.|   :.:.:|.|:|||.:        ::||:.      
  Fly  1313 EDLLLKNPYLYKNGRLGVAYRPHDFWLI---LLDALYQSLVIFFVALCAYAESDVGIWE------ 1368

plant  1056 GGQTADMDAMGTAMFTCIIWAVNVQIALTMSHFTWIQHVL-IWGSIVTWYIFLALFGMLPPKVSG 1119
                     .||.:....::|..|..|:.:..:| :.||| |..|:.::|:|..::    ..|..
  Fly  1369 ---------FGTTITASCLFANLVHCAIEIRSWT-VLHVLSIVLSLGSFYLFAIVY----DSVCM 1419

plant  1120 NIFHMLSE-----TLAPAPIFWLTSLLVIAATTLPYLAYISFQRSLNPLDH-HIIQEIKHFRIDV 1178
            |.|.:.|.     ....:.:.||..:|......||.|...:.:.||.|.|. .:|.:.|..|  .
  Fly  1420 NCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRER--S 1482

plant  1179 QDECM---WTRERS 1189
            :.|.:   |:|..|
  Fly  1483 RGEALLVTWSRSTS 1496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT3G13900NP_188006.4 PhoLip_ATPase_N 42..108 CDD:292826 28/90 (31%)
ATPase-Plipid 58..1170 CDD:273734 417/1293 (32%)
Cation_ATPase 551..655 CDD:289987 44/132 (33%)
HAD_like <859..912 CDD:304363 35/53 (66%)
PhoLip_ATPase_C 912..1162 CDD:292829 85/267 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 415/1274 (33%)
E1-E2_ATPase 302..>394 CDD:278548 35/92 (38%)
Cation_ATPase <880..965 CDD:289987 35/87 (40%)
HAD_like <1177..1240 CDD:304363 42/63 (67%)
PhoLip_ATPase_C 1223..1468 CDD:292829 86/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.