DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AT2G48020 and CG33282

Sequence 1:NP_566120.1 Gene:AT2G48020 AraportID:AT2G48020 Length:463 Species:Arabidopsis thaliana
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:460 Identity:116/461 (25%)
Similarity:213/461 (46%) Gaps:56/461 (12%)


plant    30 LSTFVAVCGSFAFGSCAGYSSPAQAAIRN-----DLSLTIAEFSLFGSLLTFGAMIGAITSGPIA 89
            |:|.:....:|..|...|:.||....|:.     |..:.:|:.|..||:|...::.|.:|...:.
  Fly    19 LATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAMLI 83

plant    90 DLVGRKGAMRVSSAFCVVGWLAIIFAKGVVALDLGRLATGYGMGAFSYVVPIFIAEIAPKTFRGA 154
            :..|||..:.:.:......|:.|..|..|..|...|...|:..||...||||||:|:|....|||
  Fly    84 ERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGA 148

plant   155 LTTLNQILICTGVSVSFIIGTLVTWRVLALIGIIPCAASFLGLFFIPESPRWLAKVGRDTEFEAA 219
            ||::..:.:..|:...:|:.|.:.:.|:..:.||...|.|:....:||:..:|.|..:....|.:
  Fly   149 LTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENS 213

plant   220 LRKLRGKKADISEEAAEIQDYIETLERLPKAKM------------LDLFQRRYIRSVLIAFGLMV 272
            .|..|.:::.|.|:.:::     ..|.|..|.:            .||..:..::....:..|.:
  Fly   214 FRYYRNQRSAICEQTSKV-----NFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSL 273

plant   273 FQQFGGINGICFYTSSIFEQAG--FPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLLLVSATGL 335
            ..||.|:.....|.|.||:.:|  .......||..::|:|....:..:||..||:.|:|:|..|:
  Fly   274 GYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGV 338

plant   336 VIGCLIAAVSFYL-KVHDMA-HEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGVAG 398
            .|||:......|| |::|:: ...:|::.:: |:.|:.:.  |:..:.::|:.|:||:.|:.:|.
  Fly   339 GIGCIAFGCFTYLAKIYDLSDFNWLPLVLMI-IICYVANI--GLIGIFFLVLVELFPVKIRSLAT 400

plant   399 GMATL---VNWFGA----------WAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVI-AIVPET 449
            .::.:   :..||.          |.:|:|.     |        ::|.:||...|.. ..:.||
  Fly   401 SLSVIFLSLLVFGTLKLFPLMLHYWGISFTM-----W--------FSAASALLTFFYFWLFLQET 452

plant   450 KGKTL 454
            |||::
  Fly   453 KGKSM 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AT2G48020NP_566120.1 Sugar_tr 32..460 CDD:278511 115/459 (25%)
MFS 32..446 CDD:119392 110/449 (24%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 110/448 (25%)
MFS_1 53..409 CDD:284993 93/364 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23500
Phylome 1 0.910 0.932 Consistency score
33.020

Return to query results.
Submit another query.