DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP1LC3B and Atg8a

DIOPT Version :8

Sequence 1:NP_073729.1 Gene:MAP1LC3B / 81631 HGNCID:13352 Length:125 Species:Homo sapiens
Sequence 2:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster

Alignment Length:115 Identity:36/116 (31%)
Similarity:66/116 (57%) Gaps:2/116 (2%)


Human     7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL 71
            :|:...||:|..:...||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68

Human    72 QLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGM 121
            .|....|.|..|| :.:...|..:..:|:...:||.|||:.|:.:..:||
  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MAP1LC3BNP_073729.1 GABARAP 7..120 CDD:176355 34/113 (30%)
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.