DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP1LC3B and Atg8a

DIOPT Version :9

Sequence 1:NP_073729.1 Gene:MAP1LC3B / 81631 HGNCID:13352 Length:125 Species:Homo sapiens
Sequence 2:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster


Alignment Length:115 Identity:36/115 - (31%)
Similarity:66/115 - (57%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL 71
            :|:...||:|..:...||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68

Human    72 QLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGM 121
            .|....|.|..|| :.:...|..:..:|:...:||.|||:.|:.:..:||
  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP1LC3BNP_073729.1 Ubl_ATG8_MAP1LC3B 5..119 CDD:340755 34/111 (31%)
Atg8aNP_727447.1 Ubl_ATG8_GABARAP 2..116 CDD:340752 34/112 (30%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.