DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and mah

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_651316.1 Gene:mah / 42988 FlyBaseID:FBgn0285912 Length:527 Species:Drosophila melanogaster

Alignment Length:447 Identity:96/448 (21%)
Similarity:167/448 (37%) Gaps:90/448 (20%)


Human    92 LAFALANTGILLFLVLLTSVTLLSIYSINLLLIC----------SKETGCMVYEKLGEQVFGTTG 146
            |...|...||||.|    |:.:|.||:..||..|          .::.....|..|.|..:|...
  Fly    89 LLVKLGYFGILLVL----SIIILQIYTSFLLSQCWTMAELLDPSIQQKRNYPYAALAELAYGPYM 149

Human   147 KFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLCL 211
            ..::.....|......:..:.:....|...:..:...:..||..|     ..:||  |::  :|.
  Fly   150 SLLVSVLLDLSIFAMAVPSVVMAAQNLEGVVLRMSAGQYNFSYCY-----WAIIV--GLV--ICP 205

Human   212 LKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCI--VPELNSTISANSTNADTCTPKYVT-FNS 273
            |..||...:..|.::..:...:::|....|   |:  .|.:.:.....|..    .|.::| .||
  Fly   206 LMWLGSPKHMRGLAIIAVCVMIVIVALLWF---CLFAAPAIGTPFEGISLE----LPGFLTVLNS 263

Human   274 KTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLTAIFGYL----TFY 334
            .::     :||.|..||.:|.:..::|.:||.....:..|:....      .||||.:    .|.
  Fly   264 YSI-----LAFQFDIHPVLLTLQIDMKQKSQVSWAALIGIAITCS------VAIFGSIIAAYKFG 317

Human   335 DNVQSDLLHKYQSKDDILILTVRLAVIVAVILTV--PVLFFTVRSSLFELAKKTKFN--LCRHTV 395
            ..:..:||....:.....::.:.:|:.:...:||  ..:|..: .:.|:|.:...|.  |.|.:|
  Fly   318 SMIADNLLQSLPTSVPFYVMLILMALQLCFSVTVASSAMFMQI-ENYFKLPESLSFKRMLIRSSV 381

Human   396 VTCILLVVINLLVIFIPSMKDIFGVVGVTSANMLIFILPSSLYLKI------------------- 441
            :...:||     ..|:||...:..|||.|....|:||||..||.:|                   
  Fly   382 LALEVLV-----AEFVPSFDALMDVVGGTITGPLVFILPPLLYRRIRRMERVHQRIAAEASYGSL 441

Human   442 -TDQDGDKGTQRIWLFLFLQFPVQP--CWLSECIILLPAALSLNMLKRKELIILCSL 495
             .|.:.|.....:...|.:..|..|  |||.          .:.:|.|.|..:.|::
  Fly   442 PLDLNYDPVDLEMEPLLVISPPTTPRGCWLR----------FVRLLHRLECDVSCTM 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 83/370 (22%)
SLC5-6-like_sbd 69..480 CDD:294310 92/431 (21%)
mahNP_651316.1 SLC5-6-like_sbd 110..426 CDD:294310 74/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97303259
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D403368at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.