DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG30394

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_611578.1 Gene:CG30394 / 37437 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster

Alignment Length:409 Identity:106/410 (26%)
Similarity:183/410 (45%) Gaps:66/410 (16%)


Human    77 VFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQV 141
            |..|:|:|:|.|||.:.|.....||||.:|||.....::....:.|:..|..|....:|.||...
  Fly     8 VMTLANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCHYLIKTSLLTRRRSFEMLGLHA 72

Human   142 FGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLV-VIVTFGI 205
            |||:||.::.........|..::|..:|.:..|..|..:...:   .|.::..|.|| |:||...
  Fly    73 FGTSGKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALD---VADHLHLRSLVMVVVTVVC 134

Human   206 ILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVT 270
            |:||.:|:|:..|......|:.    |.:.:|.|      ||.|....|:||.            
  Fly   135 IVPLGMLRNVDSLSAVCTASIG----FYVCLILK------IVLEAQPHITAND------------ 177

Human   271 FNSKTVY--------ALPTIAFAFVCHPSVLPIYSELKDRSQKKMQ-MVSNISFFAMFVMYFLTA 326
            :..|.:|        .||..:.|..|...:..::..:.::|..|:. :|.|.::...|| |....
  Fly   178 WTEKVLYWEPAGVLQCLPIFSMALSCQMQLFEVFESINNQSLDKLNGIVRNATWICTFV-YISVG 241

Human   327 IFGYL-----TFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKT 386
            .|||:     ||..|:..:|...:.|  ||    :::..::::..:.|::.|..|:||:.|..:.
  Fly   242 FFGYVAFCTHTFSGNILVNLSTSFGS--DI----IKIGFVLSIAFSFPLVIFPCRASLYSLLYRK 300

Human   387 KFNLCRHT------------VVTCILLVVINLLV-IFIPSMKDIFGVVGVTSANMLIFILPSSLY 438
                 .||            .:| |.:||.:|.| :.|||::.|.|:||.|....:..:.|:|.:
  Fly   301 -----GHTESSSYIPEQRFRFIT-IFIVVFSLCVALVIPSVELIIGLVGSTIGVAICIMFPASSF 359

Human   439 LKITDQDGDKGTQRIWLFL 457
            .||..::..:.|...::|:
  Fly   360 RKIIKKESMERTLAQFVFV 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 103/392 (26%)
SLC5-6-like_sbd 69..480 CDD:294310 106/410 (26%)
CG30394NP_611578.1 SdaC 8..392 CDD:223884 106/410 (26%)
SLC5-6-like_sbd 8..390 CDD:294310 106/410 (26%)
DUF4775 <394..652 CDD:292620
YukC <561..660 CDD:295067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4114
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.