DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and VGAT

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_610938.1 Gene:VGAT / 36574 FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster

Alignment Length:464 Identity:108/465 (23%)
Similarity:185/465 (40%) Gaps:91/465 (20%)


Human    12 ELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSLGMS 76
            |.|:.:..|.|.....::.|.:.......|.|:.:.|.....        |.||:        .:
  Fly    98 EYQSTSFNEYDGRYQQTDGFRQGSIASEGSSFVCEGEGGGGC--------KIDEF--------QA 146

Human    77 VFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKE----TGCMV---- 133
            .:|::|||.|..|:.|.||:.:.|... :|.:..:..:..|:..:|:.|..|    ||.||    
  Fly   147 AWNVTNAIQGMFIVSLPFAVLHGGYWA-IVAMVGIAHICCYTGKVLVQCLYEPDPATGQMVRVRD 210

Human   134 -YEKLGEQVFG-TTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRV 196
             |..:.:..|| ..|...:..|..::.....:.|: :|..:|      |.|   |:.....|.|.
  Fly   211 SYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYV-VVCGDL------LAG---TYPQGSFDSRS 265

Human   197 LVVIVTFGI-ILPLCLLKNLGYLGYTSGF-SLSCMVFFLIVVIYKKFQIPCIVPELNSTISANST 259
            .::.|  || :||:..||:|..:...|.: ::|.:|...:::.|...||                
  Fly   266 WMLFV--GIFLLPMGFLKSLKMVSTLSFWCTMSHIVINAVILGYCLLQI---------------- 312

Human   260 NADTCTPKYVTFN---SKTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVM 321
             .|....| |.|:   .....:|..|.|::.....:..:...:.|||  |...:.:.|..|..| 
  Fly   313 -GDWGWSK-VRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRS--KFNWMLDWSHIAAAV- 372

Human   322 YFLTAIFGY---LTFYDNVQ---SDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFT----VR 376
              ..|.|||   |||.::.|   ::.||....|.     .|...:::..:|:.|:.::.    :.
  Fly   373 --FKAGFGYICFLTFQNDTQQVITNNLHSQGFKG-----MVNFFLVIKALLSYPLPYYAACELLE 430

Human   377 SSLFELAKKTKF----NLCRHTVVTCI-----LLVVINLLVIFIPSMKDIFGVVGVTSANMLIFI 432
            .:.|....||||    ||.....|..:     ::|...|:.||||....:.|.:|..:..||.||
  Fly   431 RNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTILMAIFIPHFSILMGFIGSFTGTMLSFI 495

Human   433 LPSSLYLKI 441
            .|...::||
  Fly   496 WPCYFHIKI 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 96/407 (24%)
SLC5-6-like_sbd 69..480 CDD:294310 97/408 (24%)
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 97/411 (24%)
SdaC 159..539 CDD:223884 92/388 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97350003
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.