DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG13743

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_610444.2 Gene:CG13743 / 35911 FlyBaseID:FBgn0033368 Length:528 Species:Drosophila melanogaster

Alignment Length:396 Identity:109/397 (27%)
Similarity:185/397 (47%) Gaps:47/397 (12%)


Human    71 TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYE 135
            :||..:.||..|:|:|||::|:.:||...|..|.|.||..|..::.||:.|::.|....|...|.
  Fly    95 SSLPQASFNYINSIVGSGVIGIPYALHRAGFGLGLALLILVAYITDYSLILMVRCGHICGRFSYP 159

Human   136 KLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSA-IKFLMGKEETFSAWYVD-GRV-- 196
            .:.|..:|..|.:::.....:....||:||..:|.:.|... ::|       |.:|... |.|  
  Fly   160 GIMEAAYGKYGYYLLSLLQFMYPFLAMISYNVVVGDTLSKVLVRF-------FPSWGGSMGAVRL 217

Human   197 -LVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN 260
             :|..|..|:::||||.||:..|...|..||:|:||.|..||.|             .:|.:...
  Fly   218 GVVFFVNVGVVMPLCLYKNVSRLARASFISLACVVFILFAVIIK-------------LMSGDYKV 269

Human   261 ADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLT 325
            .|| ...:...||..:.|...:.|||:||.:...:|..::|.:.::.:.|::||....:.:..|.
  Fly   270 TDT-AESWRFANSDLIPATGIMVFAFMCHHNTFLVYQSMRDATMERWEKVTHISIGFAWTVAALF 333

Human   326 AIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKK----- 385
            .|.||.||....|.|||..|...||::..: |:...::::||.|:..|..|..:..|..:     
  Fly   334 GIAGYSTFRALSQGDLLENYCWDDDLMNFS-RVLFSISILLTFPIECFVSREIVRALVHRFVLKE 397

Human   386 --TKFNLCRHTVVTCILLV-----VINLLVIF----IPSMKDIFGVV----GVTSANMLIFILPS 435
              ::|...:...:....::     .|.:.::|    |..|.|..|.|    |:.:|..|.:|||.
  Fly   398 PISEFTQDKDPSLEKGAIIDEYSKAITMAIVFSAFVISPMTDCLGSVLELNGLLAAIPLAYILPG 462

Human   436 SLYLKI 441
            ..|:::
  Fly   463 LAYIQM 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 109/395 (28%)
SLC5-6-like_sbd 69..480 CDD:294310 109/397 (27%)
CG13743NP_610444.2 SLC5-6-like_sbd 95..500 CDD:294310 109/397 (27%)
SdaC 95..491 CDD:223884 109/397 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.