DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG13384

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_723383.1 Gene:CG13384 / 34160 FlyBaseID:FBgn0032036 Length:504 Species:Drosophila melanogaster

Alignment Length:486 Identity:103/487 (21%)
Similarity:192/487 (39%) Gaps:95/487 (20%)


Human     9 ELTELQNM-TVPEDDN------------ISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK 60
            :||.|.|: .:||...            :.:|::|: |...|.. ::.:.......:|.|.|.|.
  Fly     3 DLTPLTNLQQIPEGAPRKKKMTERQPLLLQSDASDY-EGSRGSA-ARPVRSSPPDNTLVNVHSED 65

Human    61 KKC-----DEYIPGT---------------TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFL 105
            ...     |:.|..|               ||...::.:|....:|:|||.:..|..|.|:.:.|
  Fly    66 SLAASGSGDDEIGSTDKSYNPTHHRDLEHPTSNFDTLVHLLKGNIGTGILAMPDAFKNAGLYVGL 130

Human   106 VLLTSVTLLSIYSINLLLICSKETGCMVYEK-----------------LGEQVFGTTGKFVIFGA 153
            .....:..:..:.:::|:.||.|. |..:::                 ||.:.:....:.::...
  Fly   131 FGTMIMGAICTHCMHMLVNCSHEL-CRRFQQPSLDFSEVAYCSFESGPLGLRRYSMLARRIVTTF 194

Human   154 TSLQNTG-AMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGY 217
            ..:...| ..:.:||:..|     ||.:|      ..:|.....:.:::..|.::.|.|::||.|
  Fly   195 LFITQIGFCCVYFLFVALN-----IKDVM------DHYYKMPVQIYLLIMLGPMILLNLVRNLKY 248

Human   218 LGYTSGFSLSCMVFFLIVVI-YKKFQIPCIVPELNSTISANSTNADTCTPKYV-TFNSKTVYALP 280
            |...|..:....|..|.:.. |....:|                 |..|.|.| |:.:..:| ..
  Fly   249 LTPVSLVAALLTVAGLAITFSYMLVDLP-----------------DVHTVKPVATWATLPLY-FG 295

Human   281 TIAFAFVCHPSVLPIYSELKDRSQ-KKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDL-LH 343
            |..:||.....|||:.:.::.... .....|.|.....:..:|.....||||.:.::|:..: |:
  Fly   296 TAIYAFEGIGVVLPLENNMRTPEDFGGTTGVLNTGMVIVACLYTAVGFFGYLKYGEHVEGSITLN 360

Human   344 KYQSKDDILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCR-----HTVVTCILLVV 403
            ..|.  |.|...||:::.||:.|:..:.|: |..::.|...::.|:..|     .||:..:|:..
  Fly   361 LPQG--DTLSQLVRISMAVAIFLSYTLQFY-VPVNIVEPFVRSHFDTTRAKDLSATVLRVVLVTF 422

Human   404 INLLVIFIPSMKDIFGVVGVTSANMLIFILP 434
            ..||...||::..|..:||..|::.|..|.|
  Fly   423 TFLLATCIPNLGSIISLVGAVSSSALALIAP 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 87/410 (21%)
SLC5-6-like_sbd 69..480 CDD:294310 87/409 (21%)
CG13384NP_723383.1 SdaC 92..484 CDD:223884 86/396 (22%)
SLC5-6-like_sbd 94..495 CDD:294310 86/394 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97279401
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.