DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG16700

DIOPT Version :8

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster

Alignment Length:508 Identity:114/509 (22%)
Similarity:200/509 (39%) Gaps:107/509 (21%)


Human     9 ELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSL 73
            :|.:.|..|||..:.....|...|.|  |...:|...:::...             ||.|.|:.|
  Fly     8 QLEKNQTATVPRQETAEGGSTGETAV--GGAAAKVTKEQDHDA-------------EYHPPTSYL 57

Human    74 GMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSK-------ETGC 131
             .::.:|....:|.|:..:..|..|.|:|:..:|...:.::||:..::|:.|||       ::.|
  Fly    58 -ETIVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVC 121

Human   132 MVYEKLGEQVF-----------GTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEE 185
            ..|.:..||.|           .|.|:.|.......|.....:.::||..|           .::
  Fly   122 ADYAQTVEQCFENGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTN-----------LKQ 175

Human   186 TFSAWYVDGRV-LVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPE 249
            ...|:.:|..| ||:::.|..:|...|:.||.:|...|.|:..||:..|.:.:|  :.:...:||
  Fly   176 ILQAYDIDMNVHLVMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLY--YALKDGLPE 238

Human   250 LNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQM-VSNI 313
            :..  .|..||           .|:......|..|||.....|:|:.:.::...|.:..: |.|:
  Fly   239 VEE--RALWTN-----------GSQLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLNV 290

Human   314 SFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTV--- 375
            ..|.:.||:......||:.:.:.|...|  .....|.||...|:|.|...|:|..|:.||..   
  Fly   291 GMFLVSVMFMFAGSVGYMKWGEQVGGSL--TLNLGDTILAQAVKLMVSAGVLLGYPLQFFVAIQI 353

Human   376 -------------RSSLFELAKKTKFNLCRHTVVTCILLVVINLLVI-FIPSMKDIFGVVGVTSA 426
                         ||.|.||..:|             .:|::.|.:. .:|::.....::|...:
  Fly   354 MWPNAKQMCGIEGRSLLGELGFRT-------------FMVLVTLAIAEMVPALGLFISLIGALCS 405

Human   427 NMLIFILPSSLYLKITDQDGDKGTQRIWLFLFLQFPVQPCWLSECIILLPAAL 479
            ..|..:.|..:.| |:..:.:|| ..||:          | :...:||:.|.|
  Fly   406 TALALVFPPVIEL-ISRSELNKG-PGIWI----------C-VKNLVILVLALL 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SdaC 68..441 CDD:223884 92/410 (22%)
SLC5-6-like_sbd 69..480 CDD:294310 101/449 (22%)
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 101/449 (22%)
SdaC 57..452 CDD:223884 100/445 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97453461
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.