DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG16700

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_573191.1 Gene:CG16700 / 32694 FlyBaseID:FBgn0030816 Length:468 Species:Drosophila melanogaster


Alignment Length:508 Identity:114/508 - (22%)
Similarity:200/508 - (39%) Gaps:107/508 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     9 ELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGTTSL 73
            :|.:.|..|||..:.....|...|.|  |...:|...:::...             ||.|.|:.|
  Fly     8 QLEKNQTATVPRQETAEGGSTGETAV--GGAAAKVTKEQDHDA-------------EYHPPTSYL 57

Human    74 GMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSK-------ETGC 131
             .::.:|....:|.|:..:..|..|.|:|:..:|...:.::||:..::|:.|||       ::.|
  Fly    58 -ETIVHLFKGNIGPGLFAMGDAFKNGGLLVAPLLTVVIAVVSIHCQHVLVTCSKKMRDLKGDSVC 121

Human   132 MVYEKLGEQVF-----------GTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEE 185
            ..|.:..||.|           .|.|:.|.......|.....:.::||..|           .::
  Fly   122 ADYAQTVEQCFENGPSKLRGWSRTMGRLVDIFICVTQLGFCCIYFVFISTN-----------LKQ 175

Human   186 TFSAWYVDGRV-LVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPE 249
            ...|:.:|..| ||:::.|..:|...|:.||.:|...|.|:..||:..|.:.:|  :.:...:||
  Fly   176 ILQAYDIDMNVHLVMLLAFVPVLLSSLITNLKWLTPVSMFANVCMILGLAITLY--YALKDGLPE 238

Human   250 LNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQM-VSNI 313
            :..  .|..||           .|:......|..|||.....|:|:.:.::...|.:..: |.|:
  Fly   239 VEE--RALWTN-----------GSQLALFFGTAIFAFEGIALVMPLKNAMRKPHQFERPLGVLNV 290

Human   314 SFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTV--- 375
            ..|.:.||:......||:.:.:.|...|  .....|.||...|:|.|...|:|..|:.||..   
  Fly   291 GMFLVSVMFMFAGSVGYMKWGEQVGGSL--TLNLGDTILAQAVKLMVSAGVLLGYPLQFFVAIQI 353

Human   376 -------------RSSLFELAKKTKFNLCRHTVVTCILLVVINLLVI-FIPSMKDIFGVVGVTSA 426
                         ||.|.||..:|             .:|::.|.:. .:|::.....::|...:
  Fly   354 MWPNAKQMCGIEGRSLLGELGFRT-------------FMVLVTLAIAEMVPALGLFISLIGALCS 405

Human   427 NMLIFILPSSLYLKITDQDGDKGTQRIWLFLFLQFPVQPCWLSECIILLPAAL 479
            ..|..:.|..:.| |:..:.:|| ..||:          | :...:||:.|.|
  Fly   406 TALALVFPPVIEL-ISRSELNKG-PGIWI----------C-VKNLVILVLALL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 101/448 (23%)
CG16700NP_573191.1 SLC5-6-like_sbd 53..452 CDD:294310 101/448 (23%)
SdaC 57..452 CDD:223884 100/444 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158577
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 1 1.010 - - D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.