DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF15 and caz

DIOPT Version :8

Sequence 1:NP_631961.1 Gene:TAF15 / 8148 HGNCID:11547 Length:592 Species:Homo sapiens
Sequence 2:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster

Alignment Length:563 Identity:193/564 (34%)
Similarity:241/564 (43%) Gaps:206/564 (37%)


Human    67 YGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQ--PDYGQQ-DSYDQQSGYDQHQGS 128
            |||...|..::::..|.|.| |..|         :..:|::  |:||:| ..||..||   |:||
  Fly     6 YGGGSGQGYNNFAVPPPNYQ-QMPN---------KTGNYNEPPPNYGKQGGGYDSGSG---HRGS 57

Human   129 YDEQSN-------YDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRG 186
            ....:.       .|:..:||.....|    :::|                 |:|:||..|||.|
  Fly    58 GGSGNGGGGGGSWNDRGGNSYGNGGAS----KDSY-----------------NKGHGGYSGGGGG 101

Human   187 RGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVG 251
            .||    |.|   |.|||:                 |..::.|     ||||.|:....:...:.
  Fly   102 GGG----GGG---GGSGGN-----------------DMITQED-----TIFVSGMDPSTTEQDIE 137

Human   252 EFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVS 316
            ..|..|||||.:|:|.||.|.||.:|:||..||||||::||..:|::||:||||::|:||.||||
  Fly   138 THFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAIEWFDGRDFNGNAIKVS 202

Human   317 FATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNE 381
            .|.|:..:.:|||.|||                                                
  Fly   203 LAQRQNNWNKGGGGGGG------------------------------------------------ 219

Human   382 PRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGY 446
                                          ||.|||:||.|.|||.||    |||      |||.
  Fly   220 ------------------------------GGGRGGFGGRRGGGGGGG----GGG------GGGG 244

Human   447 GGDRSGGGYGG--DRGGGYGGDRGGGYGGDRGGGY-----------------------GGDRGGY 486
            ..||.|||.||  |||||.||..|||....|.|.:                       |.|.|..
  Fly   245 RFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSS 309

Human   487 GGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYG- 550
            ||..||||||..||.|.||   |.|||..|   ||| .:|.||  |..:|||.|.||  .|||. 
  Fly   310 GGGGGGGYGGGGGGGGYDR---GNDRGSGG---GGY-HNRDRG--GNSQGGGGGGGG--GGGYSR 363

Human   551 -GDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY 592
             .|.:|||.|| |||| ||:|.. ||.|  |||  ...|:|||
  Fly   364 FNDNNGGGRGG-RGGG-GGNRRD-GGPM--RND--GGMRSRPY 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TAF15NP_631961.1 G_path_suppress <1..124 CDD:318248 18/60 (30%)
RRM 136..>315 CDD:330708 64/179 (36%)
RRM_FUS_TAF15 232..317 CDD:240979 43/85 (51%)
zf-RanBP 354..384 CDD:279035 0/30 (0%)
RanBP2-type Zn finger 358..379 CDD:275375 0/21 (0%)
21 X approximate tandem repeats of D-R-[S,G](0,3)-G-G-Y-G-G 407..575 89/195 (46%)
cazNP_523365.2 RRM <118..>205 CDD:223796 45/92 (49%)
RRM_SARFH 122..204 CDD:240978 42/82 (51%)
zf-RanBP 275..304 CDD:279035 3/29 (10%)
RanBP2-type Zn finger 279..298 CDD:275375 0/19 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C117258107
eggNOG 1 0.900 E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2706
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1539664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23238
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.