DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FOSL1 and kay

Sequence 1:NP_005429.1 Gene:FOSL1 HGNCID:13718 Length:271 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:266 Identity:70/267 (26%)
Similarity:101/267 (38%) Gaps:93/267 (35%)


Human    91 GVRRRP--CEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEE 153
            |..|||  ...::||||::|.|||||||.|||:||.||.:.|:.|..|.::||.....:::|||.
  Fly   402 GGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEV 466

Human   154 LQKQKERLELVLEAHRPICK----------------IPEG-AKEGDTG----------------- 184
            |...|.:||.:|..||..|:                .|.| ...|.:|                 
  Fly   467 LTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNG 531

Human   185 ----------STSGTSSP-----------------------------------PAPCRPVPCISL 204
                      ||..::||                                   |.|.:.:....:
  Fly   532 TITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPM 596

Human   205 SPGPVLEPEALHTPTLMTTPSL-TPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLG---- 264
            |..|.:....:.|||..::.|| ||.|       .:.|....||...:|:.|...:.:.:|    
  Fly   597 STMPHVHLSTILTPTGASSGSLQTPIT-------STAPGGFGSAFPVTSNGSSINNINSIGNNMN 654

Human   265 SPTLLA 270
            ||||.|
  Fly   655 SPTLNA 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FOSL1NP_005429.1 Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 107..127 15/20 (75%)
bZIP_Fos 115..168 CDD:269869 22/53 (42%)
coiled coil 115..167 CDD:269869 22/52 (42%)
PRK13729 129..>250 CDD:184281 39/201 (19%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 133..161 9/28 (32%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 28/61 (46%)
coiled coil 421..480 CDD:269869 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 1 1.000 T608829
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.