DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSRP3 and Mlp84B

Sequence 1:NP_003467.1 Gene:CSRP3 HGNCID:2472 Length:194 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster

Alignment Length:180 Identity:87/181 (48%)
Similarity:106/181 (59%) Gaps:9/181 (5%)


Human     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGY 73
            ||..|.|:||.|||....|..|||.||.|..|.|:||||....||.|:|||.|:||::||||.|:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Human    74 GQGAGCLSTDTGEHLGLQFQQSPKPARSVTTS---NPSKFTAKFGESEKCPRCGKSVYAAEKVMG 135
            |.|||.||.|.|.    ||.:......||...   .| :..|:..|.|.|||||..|||||:::.
  Fly    76 GTGAGTLSMDNGS----QFLRENGDVPSVRNGARLEP-RAIARAPEGEGCPRCGGYVYAAEQMLA 135

Human   136 GGKPWHKTCFRCAICGKSLESTNVTD-KDGELYCKVCYAKNFGPTGIGFG 184
            .|:.|||.||:|..|.|.|:|....: .|..:|||.||||.|||.|.|:|
  Fly   136 RGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYG 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSRP3NP_003467.1 Interaction with TCAP. {ECO:0000269|PubMed:12507422} 1..5
LIM1_CRP3 9..62 CDD:188865 29/53 (55%)
Nuclear localization signal. {ECO:0000250|UniProtKB:P50463, ECO:0000255} 64..69 3/5 (60%)
Interaction with CLF2 and isoform 2. {ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983} 94..105 2/11 (18%)
LIM2_CRP3 120..173 CDD:188866 27/54 (50%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 29/53 (55%)
LIM_CRP_like 120..173 CDD:188712 26/53 (49%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 1 1.000 FOG0000884
OrthoInspector 1 1.000 T609080
orthoMCL 1 0.900 OOG5_128738
Panther 1 1.100 O PTHR24215
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4662
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.