DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZDHHC11 and CG17198

Sequence 1:XP_016865358.1 Gene:ZDHHC11 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_001287532.1 Gene:CG17198 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster

Alignment Length:299 Identity:66/300 (22%)
Similarity:99/300 (33%) Gaps:114/300 (38%)


Human    24 LPPRISRVNGWS------------LPLHYFQV-VTWAVFVGLSSATFGIFIPFLPHAWKYIAYVV 75
            :|.|:..:..|:            |..::|:. .....|:||    ||..:.||...|  |.|.:
  Fly    25 IPRRVGAIKSWTDIMGVSINVCIILFFYFFEAFYVMPQFLGL----FGQAVHFLVTTW--IVYNI 83

Human    76 TGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVPQHPPP 140
            ...:       .|..:.::..||   |.....|||...:...|       ||.:|:..       
  Fly    84 LENL-------RLCVTTLNTVDS---LPPQMQQPMKGEEHLWH-------FCKICQRN------- 124

Human   141 ASHSLLDALSPGRTGLVPPRHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSG 205
                            ||||                                :.||..|:.|:..
  Fly   125 ----------------VPPR--------------------------------SWHCNICDACILK 141

Human   206 FDHHCKWINNCVGSRN----YWF-FFSTVASATA-------------GMLCLIAILLYVLVQYLV 252
            .||||.::.||||..|    .|| |::.:.||.|             |...|:. ..|::....:
  Fly   142 RDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVALFDNFMLAHKHGVGFFDLVK-ANYIIFNAYM 205

Human   253 NPG--VLRTDPRYEDVKNMNTWLLFLP--LFPVQVQTLI 287
            |||  .|....|...|..:|.:.:..|  ||..||.|:|
  Fly   206 NPGRKELVIFYRIVSVLGVNIFAVLFPAALFCTQVVTVI 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 46/211 (22%)
zf-DHHC 111..252 CDD:279823 44/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.