powered by:
Protein Alignment ZDHHC11 and GABPI
DIOPT Version :9
| Sequence 1: | XP_016865358.1 |
Gene: | ZDHHC11 / 79844 |
HGNCID: | 19158 |
Length: | 559 |
Species: | Homo sapiens |
| Sequence 2: | NP_608741.1 |
Gene: | GABPI / 33516 |
FlyBaseID: | FBgn0031495 |
Length: | 420 |
Species: | Drosophila melanogaster |
| Alignment Length: | 76 |
Identity: | 26/76 - (34%) |
| Similarity: | 38/76 - (50%) |
Gaps: | 6/76 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Human 191 KKTKHCISCNKCVSGFDHHCKWINNCVGSRNY-WFF----FSTVASATAGMLCLIAIL-LYVLVQ 249
::..||..|..||...|||..|:|.|:|.||| |:. .|.:|......|.|.:|. .:::|:
Fly 277 RRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVR 341
Human 250 YLVNPGVLRTD 260
.|..|.:|..|
Fly 342 PLGYPVLLPDD 352
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| ZDHHC11 | XP_016865358.1 |
None |
| GABPI | NP_608741.1 |
zf-DHHC |
262..399 |
CDD:279823 |
26/76 (34%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5273 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.