DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and GABPI

DIOPT Version :10

Sequence 1:XP_024301977.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:510 Species:Homo sapiens
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:76 Identity:26/76 - (34%)
Similarity:38/76 - (50%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   191 KKTKHCISCNKCVSGFDHHCKWINNCVGSRNY-WFF----FSTVASATAGMLCLIAIL-LYVLVQ 249
            ::..||..|..||...|||..|:|.|:|.||| |:.    .|.:|......|.|.:|. .:::|:
  Fly   277 RRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVR 341

Human   250 YLVNPGVLRTD 260
            .|..|.:|..|
  Fly   342 PLGYPVLLPDD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_024301977.1 DHHC 193..316 CDD:396215 26/74 (35%)
GABPINP_608741.1 DHHC 262..399 CDD:396215 26/76 (34%)

Return to query results.
Submit another query.