DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K2C and PIP4K

DIOPT Version :9

Sequence 1:NP_001139730.1 Gene:PIP4K2C / 79837 HGNCID:23786 Length:421 Species:Homo sapiens
Sequence 2:NP_001033805.1 Gene:PIP4K / 3885565 FlyBaseID:FBgn0039924 Length:404 Species:Drosophila melanogaster


Alignment Length:410 Identity:210/410 - (51%)
Similarity:274/410 - (66%) Gaps:47/410 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    29 KKKHF--VQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHR 91
            |||||  ..||||:|||.:|::.||:||:.|:|||||.|..|||||||||:|.|||||:||||::
  Fly    15 KKKHFRVKHQKVKLFRANEPILSVFMWGINHTINELSHVNIPVMLLPDDFRAYSKIKVDNHLFNK 79

Human    92 ENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPP--SESEGSDG-RFLISYDRTLVIKE 153
            ||:|||||.|||||.||||||:|||:||.||..||||:.|  .:|.|..| :|..|||:..:||.
  Fly    80 ENMPSHFKVKEYCPLVFRNLRERFGVDDVDYRESLTRSQPIQIDSSGKSGAQFYQSYDKFFIIKS 144

Human   154 VSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYD 218
            ::||:|..||:.|..||.|:|:.||.|||||:|||||::|::...|.:||||:||..|.:|:|:|
  Fly   145 LTSEEIERMHAFLKQYHPYVVERHGKTLLPQYLGMYRITVESVQYYFVVMRNVFSSHLTIHKKFD 209

Human   219 LKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSL 283
            ||||.|.||||:||..|.|||.||.||:.:..|:.||:|.|...::.|..||:.|.:|.||||||
  Fly   210 LKGSTVDREASEKELEKNLPTFKDNDFIKQKVKLDIGKEAKDKLMDTLSNDVDLLTKLHIMDYSL 274

Human   284 LLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVG----------------SYGTSPEGI 332
            |:|:||.:|.   ||||        :.||..||     ||                :|.|.|:..
  Fly   275 LVGVHDCVRA---EEEA--------LQGDNILT-----VGRSENSESEECDSGERWTYNTPPDSP 323

Human   333 GGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAG 397
            .|..:.       |....:|:|.|.|.|  .::|:||:.:||:||||..||:||.||||||:|:.
  Fly   324 RGAQYK-------EVVYEVDIYDIPSIE--EKREIYFIAIIDVLTQYGVKKQAAKAAKTVKYGSN 379

Human   398 AE-ISTVHPEQYAKRFLDFI 416
            .: |||..|||||||||||:
  Fly   380 VDGISTCDPEQYAKRFLDFM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4K2CNP_001139730.1 Required for interaction with PIP5K1A. /evidence=ECO:0000269|PubMed:31091439 69..75 5/5 (100%)
PIPKc 72..420 CDD:214623 182/365 (50%)
PIP4KNP_001033805.1 PIPKc 32..403 CDD:295374 198/393 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 281 1.000 Domainoid score I1678
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 455 1.000 Inparanoid score I1592
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52363
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 1 1.000 - - FOG0001219
OrthoInspector 1 1.000 - - otm41537
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23086
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X950
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.