DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIP4K2C and PIP5K59B

Sequence 1:NP_001139730.1 Gene:PIP4K2C HGNCID:23786 Length:421 Species:Homo sapiens
Sequence 2:NP_001036566.4 Gene:PIP5K59B FlyBaseID:FBgn0034789 Length:781 Species:Drosophila melanogaster

Alignment Length:408 Identity:120/409 (29%)
Similarity:206/409 (50%) Gaps:56/409 (14%)


Human    47 LVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHREN---LPSH----FKFKEYC 104
            ::|....|:.|::..|:..|...:|:.|.:      ::.:..|..|.   .|:|    |::|.|.
  Fly    80 IMGSIQLGIQHTVGSLASKPKRDLLMMDFW------EIESITFPPEGSSLTPAHHYSEFRYKIYA 138

Human   105 PQVFRNLRDRFGIDDQDYLVSLTRNPPSE--SEGSDGR-FLISYDRTLVIKEVSSEDIADMHSNL 166
            |..||..||.|||...|:::|:..:|..|  :.|:.|. |.::.|...:||.|..::...:...|
  Fly   139 PIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLL 203

Human   167 SNYHQYIVKCHGNTLLPQFLGMYRVSVDN-EDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASD 230
            ..|:..:.: :..||||:|.|:|.:...| ::..::||.|:....:.:|.|||||||...|:|:.
  Fly   204 PGYYMNLNQ-NPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANK 267

Human   231 KEKVKELPTLKDMDFLNKNQK-VYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDI---I 291
            .|:.|:.||.||:||:.::.. :::..|.....::.::||...|...||||||||||:|::   :
  Fly   268 AERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL 332

Human   292 RGSEPEEEAPVR---EDESEVDGDCSLTGPPA-----------------LVGSYGTSPEGIGGY- 335
            :..:.|:..|:|   .::|:||.|..|.|..|                 || ::.|:.|.|... 
  Fly   333 KEKQSEQRKPLRAPLAEDSDVDADDPLDGDAATGISRNNAAYRSVNRQRLV-AHSTAMESIQAES 396

Human   336 --IHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGA 398
              |.....:.||...:       ||.:|  ::.:.::|:||||..|..|||..|..|::.|. |.
  Fly   397 EPIDDEEDVPPGGIPA-------RSEKG--ERLLLYIGIIDILQSYRLKKKLEHTFKSIIHD-GE 451

Human   399 EISTVHPEQYAKRFLDFI 416
            .:|...|..||:||.:|:
  Fly   452 TVSVCRPSFYAQRFQNFM 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIP4K2CNP_001139730.1 PIPKc 72..420 CDD:214623 114/384 (30%)
PIP5K59BNP_001036566.4 PIPKc 104..473 CDD:214623 115/385 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.