DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIP4K2C and sktl

Sequence 1:NP_001139730.1 Gene:PIP4K2C HGNCID:23786 Length:421 Species:Homo sapiens
Sequence 2:NP_001286646.1 Gene:sktl FlyBaseID:FBgn0016984 Length:792 Species:Drosophila melanogaster

Alignment Length:482 Identity:128/483 (27%)
Similarity:216/483 (45%) Gaps:84/483 (17%)


Human     1 MASSSVPPATVSAATA------GPGPGFGFASKTKKKHFVQQKVKVFRAAD------------PL 47
            :|::..|.:.:.:|::      ...|     |.|..||  ::|:...|.|:            .:
  Fly   102 IAATQTPASKLRSASSTLDASISRNP-----STTGGKH--EKKLGHRRVAEGGEVTYKKIQSKQI 159

Human    48 VGVFLWGVAHSINELSQVPPPVMLLPDDFKA--------SSKIKVNNHLFHRENLPSHFKFKEYC 104
            :|....|:.|::..|:..|...:|:.|.::.        .|.|...:|.       :.|:||.|.
  Fly   160 MGSIQLGIQHTVGSLASKPKRDLLMNDFWEMETISFPPDGSSITPAHHY-------NDFRFKVYA 217

Human   105 PQVFRNLRDRFGIDDQDYLVSLTRNPPSE--SEGSDGR-FLISYDRTLVIKEVSSEDIADMHSNL 166
            |..||..||.|||...|:|:|:..:|..|  :.|:.|. |.::.|...:||.|..::...:...|
  Fly   218 PIAFRYFRDLFGIAPDDFLMSMCASPLRELSNPGASGSIFYLTTDDEFIIKTVQKKECEFLQKLL 282

Human   167 SNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDK 231
            ..|:..:.: :..||||:|.|:|....::::..::.|.|:....:.:|.|||||||...|:||..
  Fly   283 PGYYMNLSQ-NPRTLLPKFFGLYCFHYNSKNVRLVAMNNLLPSDIKMHCKYDLKGSSFRRKASKA 346

Human   232 EKVKELPTLKDMDFLNKNQK-VYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDI-IRGS 294
            |:.|..||.||:||...:.. :::..::....:..:|||...|...:|||||||:|||:: :...
  Fly   347 ERQKASPTFKDLDFAEHHPNGIFLETDKYNALMSTIKRDCMVLESFQIMDYSLLVGIHNLDLAAK 411

Human   295 EPEEE------APVREDESEVDGDCSLT----GPPA------LVGSYGTSP-EGIGGYIHSHRPL 342
            |..||      |.::..||...|..||.    .|.|      .|.||.:.| ...|..::..|.:
  Fly   412 EKREERILNARAKLQRKESAAQGPPSLNPDDDAPEADQNQLQAVASYASIPGTSAGAALNRTRSM 476

Human   343 G--------------------PGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAH 387
            .                    |.|.:..:....|.:.....::.:.::|:||||..|..:||..|
  Fly   477 NRQRLVAHSTALESITADMDVPLEEDEDVPAGGIPARSENDERLILYIGIIDILQSYRLEKKLEH 541

Human   388 AAKTVKHGAGAEISTVHPEQYAKRFLD 414
            ..|::.:. |..:|...|..|||||.|
  Fly   542 TFKSILYN-GDTVSVCRPSFYAKRFQD 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIP4K2CNP_001139730.1 PIPKc 72..420 CDD:214623 111/394 (28%)
sktlNP_001286646.1 PIPKc 183..573 CDD:214623 112/395 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.