DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pex6 and Pex6

Sequence 1:XP_001332652.5 Gene:pex6 ZFINID:ZDB-GENE-081104-252 Length:1071 Species:Danio rerio
Sequence 2:NP_001027403.2 Gene:Pex6 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster

Alignment Length:754 Identity:259/755 (34%)
Similarity:390/755 (52%) Gaps:115/755 (15%)


Zfish   383 IKIKRWNKASSHTDPQISASACRCSSPPFAKELHIETIISPDYSALGLFSSVLHTHFSKPRLVQQ 447
            |:...|.:.....|.|        :.|..|.:.|:..:..|......|...:|..:|:.|||:.:
  Fly   193 IRSNCWVQVEHFADEQ--------TIPGIATKAHVYLVADPHELPAELTEVILSNYFNTPRLMHR 249

Zfish   448 GNILAVPTQGHPELMENGSEGVLRWPVLYFRVKQA---C---GFSSEEEEASSYLADSSHTSLYM 506
            |:...:  :.:.||:  |:.....:.:::..::..   |   .....|.|..:.:| .:.::|..
  Fly   250 GHTYRI--EVNAELV--GTATYAHYYLIFAHLRHVHLKCIHLETKGSEFELQAIVA-KNFSNLVQ 309

Zfish   507 GGSAHSLCPYSVLPEASSFWTSLSPPGLSSTVEKLITIIQPHLNESTLILKRGC--------SIL 563
            ..::||..|..||.  |.......|.||....:.|.:.:...|.:     |..|        ..|
  Fly   310 VPASHSFLPRQVLD--SMAIVENYPSGLRKPYKLLRSSVDAFLPK-----KSACLSSKHIFPVFL 367

Zfish   564 LMGPNGSGKFTAVRAVSRRLHLHLIKVDCVTLCADTAAASEAKIKSVFERAELHHPCLLLLRNLQ 628
            |.|..||||...|.||::.|.:|:...||..:.:...:.:|.|:|:||.::::..|.::...|.:
  Fly   368 LQGERGSGKSKLVSAVAQELGMHIYGADCAEIVSQVPSHTEMKLKAVFAKSQVCEPLMICFHNFE 432

Zfish   629 LLGQSRDGAETDCRVAATLCQLIAAVHTSV-----------VVVGSVSSQHELPSDVMAAFVHQV 682
            :.|...:|.| |.|       |::|.|..|           :||.:::|...|...:...|:..:
  Fly   433 IFGIDNEGNE-DLR-------LLSAFHVQVQELFNRDRKHPIVVVALTSDRHLKPMIQGLFLEII 489

Zfish   683 AIESLSEDQRRMVL---------------SSLSEDLLLGKDVN------------------LGRI 714
            .|:..|:::|..:|               ....|.|.|....|                  |..:
  Fly   490 NIDMPSKEERFEILRWMHVRETFNDIIYNQKAIEQLPLFSRENQSQFMPRISPSWRETLNVLQDV 554

Zfish   715 AKQTAGFVLGDLCALLTNAGKAAHR-RLVETYFPEAVSEQEEEDLCVSGVSVTSEDFSAALDVLQ 778
            |.::.||:||||..|..||.:...| ||..|                   ::....|:..|..:|
  Fly   555 AAKSQGFLLGDLQLLYDNAVRMKIRNRLGRT-------------------TLDMSHFAKNLTDMQ 600

Zfish   779 EAHSQAIGAPKIPAVSWQDVGGLQQVKKEILDTIQLPLEHPELLSLGLRRSGLLLYGPPGTGKTL 843
            .:.:.::||||:|.|.|.|:|||.::|.||..:|.|||:|..|:...|||||:||||||||||||
  Fly   601 SSFADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPLKHVHLMGKNLRRSGILLYGPPGTGKTL 665

Zfish   844 LAKAVATECTMTFLSVKGPELINMYVGQSEENIRQVSSKARSAAPCIIFFDELDSLAPNRGHSGD 908
            :||||||||.::||||:||||:||||||||:|:|:|.|:|||||||::|.|||||||||||.:||
  Fly   666 VAKAVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSAAPCVLFLDELDSLAPNRGVAGD 730

Zfish   909 SGGVMDRVVSQLLAELDGLHSSGD----VFVIGATNRPDLLDQSLLRPGRFDKLVYVGINEDRES 969
            |||||||||||||||:||: |.||    :|::.|||||||:|.:||||||||||.|||.....|.
  Fly   731 SGGVMDRVVSQLLAEMDGM-SDGDTSKPIFILAATNRPDLIDPALLRPGRFDKLFYVGPCSTAED 794

Zfish   970 QLQVLKAILRKFKVDASVCLSDIVESCPPRLTGADLYSLCSDAMMCAVKRKISRITEGVDSEL-- 1032
            :..||:|..::|.:||.|.:..|.|.....::||||||:||:|.:.||:|.|.....|..||.  
  Fly   795 KAAVLRAQTQRFALDAGVDMEQIAERLKSEMSGADLYSICSNAWLSAVRRTIDGHLSGTISEKEL 859

Zfish  1033 --SSLTLCSEDFSEALSGLQPSVSEQQISRYQLLQQKLS 1069
              .::.:..|||:::.:...||:|.:.:..:..|:...|
  Fly   860 VPENVIVQEEDFTKSFNKFVPSISAKDLEYFNNLKASYS 898

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pex6XP_001332652.5 SpoVK 561..1060 CDD:223540 221/552 (40%)
P-loop_NTPase 562..>620 CDD:304359 20/58 (34%)
AAA 834..962 CDD:278434 100/132 (76%)
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 212/508 (42%)
P-loop_NTPase 367..492 CDD:304359 36/133 (27%)
AAA 653..787 CDD:278434 102/135 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332353898
eggNOG 1 0.900 E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 377 1.000 Inparanoid score I2002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D233419at2759
OrthoFinder 1 1.000 FOG0000162
OrthoInspector 1 1.000 T1051664
orthoMCL 1 0.900 OOG5_129222
Panther 1 1.100 LDO PTHR23077
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R903
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.