DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HSD17B8 and CG12171

Sequence 1:NP_055049.1 Gene:HSD17B8 HGNCID:3554 Length:261 Species:Homo sapiens
Sequence 2:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster

Alignment Length:259 Identity:80/260 (31%)
Similarity:128/260 (49%) Gaps:23/260 (9%)


Human    10 RSALALVTGAGSGIGRAVSVRLAGEGA--TVAACDLDR--AAAQETVRLLGGPGSKEGPPRGNHA 70
            :..:.:||||.||||...||.||..|.  |:...:||:  ..|::.|...|.|..:......:.:
  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69

Human    71 AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVT 135
            ..|..||...|....::           |:|:.|||.:...:.:.|.:.:|:|:..|::..:.:|
  Fly    70 DVQGIVSATLAKHGRID-----------VLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLT 123

Human   136 QAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPG 200
            ......|:..  :|:|:|:||:.|.....|...|..|||.|...|:..|.||...|:|.|||.||
  Fly   124 HLVTPELIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPG 186

Human   201 FIATPMTQK--VPQKVVDKITEMIPMGH-LGDP---EDVADVVAFLASEDSGYITGTSVEVTGG 258
            .|.|.:.::  :.|:...|..|...:.| ||.|   ::||..:|||||:::.:.||.|:.|.||
  Fly   187 VIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 80/257 (31%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/260 (31%)
NADB_Rossmann 4..254 CDD:304358 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126618
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.