DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZNF121 and pita

Sequence 1:NP_001008727.1 Gene:ZNF121 HGNCID:12904 Length:390 Species:Homo sapiens
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:232 Identity:78/233 (33%)
Similarity:123/233 (53%) Gaps:6/233 (3%)


Human   165 THTGEK----PYECKECGKCFTVSSHLVEHVRIHTGEKPYQCKECGRAFAGRSGLTKHVRIHTGE 225
            |...||    .:.|.:|.:.|.:...|..|...||..:.:||..|.::|..:..|.||..:||||
  Fly   275 TKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGE 339

Human   226 KPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKSFRSSSCLKNHFRIHTGIKPYKCKECG 290
            :|::|..|.||:.|..||..|.:|||:...|.|..|.|.|.|...::.|...|...:|::|..|.
  Fly   340 RPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCT 404

Human   291 KAFTVSSSLHNHVKIHTGEKPYECKDCGKAFATSSQLIEHIRTHTGEKPYICKECGKTFRASSHL 355
            |:|.....|..|..:|:...|:.|:.|.::|:|:|:|..|:..|.|::.|.||.|.|::..|.||
  Fly   405 KSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHL 469

Human   356 QKHVRIH--TGEKPYICNECGKAYNRFYLLTKHLKTH 390
            .:|:|.|  |.:..::|:||..:|:.:..|..|...|
  Fly   470 SRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIH 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZNF121NP_001008727.1 C2H2 Zn finger 65..82 CDD:275368
COG5048 <85..270 CDD:227381 39/109 (36%)
C2H2 Zn finger 91..110 CDD:275368
C2H2 Zn finger 119..138 CDD:275368
zf-C2H2 144..166 CDD:278523 1/1 (100%)
C2H2 Zn finger 146..166 CDD:275368 1/1 (100%)
zf-H2C2_2 158..182 CDD:290200 6/21 (29%)
C2H2 Zn finger 174..194 CDD:275368 5/20 (25%)
zf-H2C2_2 186..210 CDD:290200 8/24 (33%)
C2H2 Zn finger 202..222 CDD:275368 6/20 (30%)
zf-H2C2_2 215..239 CDD:290200 12/24 (50%)
COG5048 <226..388 CDD:227381 56/164 (34%)
C2H2 Zn finger 230..250 CDD:275368 9/20 (45%)
zf-H2C2_2 243..267 CDD:290200 10/24 (42%)
C2H2 Zn finger 258..278 CDD:275368 6/20 (30%)
zf-H2C2_2 271..294 CDD:290200 7/23 (30%)
C2H2 Zn finger 286..306 CDD:275368 6/20 (30%)
zf-H2C2_2 301..323 CDD:290200 6/22 (27%)
C2H2 Zn finger 314..334 CDD:275368 7/20 (35%)
zf-H2C2_2 327..349 CDD:290200 9/22 (41%)
C2H2 Zn finger 342..362 CDD:275368 9/20 (45%)
zf-H2C2_2 354..379 CDD:290200 10/27 (37%)
C2H2 Zn finger 370..390 CDD:275368 6/20 (30%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 74/225 (33%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 6/20 (30%)
zf-H2C2_2 328..353 CDD:290200 12/25 (48%)
C2H2 Zn finger 344..364 CDD:275368 9/20 (45%)
C2H2 Zn finger 372..388 CDD:275370 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 6/20 (30%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 9/20 (45%)
C2H2 Zn finger 486..506 CDD:275368 6/20 (30%)
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3885
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.